KEGG   Lysobacter gummosus: LG3211_1594Help
Entry
LG3211_1594       CDS       T04163                                 

Definition
(GenBank) angiotensin-converting enzyme family protein
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lgu  Lysobacter gummosus
Brite
Enzymes [BR:lgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     LG3211_1594
Peptidases [BR:lgu01002]
 Metallo Peptidases
  Family M2
   LG3211_1594
Exosome [BR:lgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LG3211_1594
CD molecules [BR:lgu04090]
 Proteins
  LG3211_1594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1762296..1764308)
Genome map
AA seq 670 aa AA seqDB search
MLALGVAAAVIGVAGCKKEPVPSSSTTAPAVAPAGETADQFIARVNDEYKKMYPEMTAAQ
WLSSTYINDDSQLLSAKANERYLTQLNSWIEQSKKFEGQQMSPATARSIQLLKIGTAMPA
PKDPARLAELTQIATRMEGMYGSGSYCSGPGDTDCRQLGDLEDVLRNSRDYDAQLDAWKG
WHTISKPMRKDYTRFVELVNEGAKNLGYADTGELWRSGYDMSPVELAAETDRLWGQVKPL
YEQLHCYTRSRLESKYGTDKGQASGGMLPAHLLGNMWQQDWGNLWDVLAPYSDQQAGSLD
INGALARQYQQILDAQEAKAGGDRGPLEQAQAEVDANLANAKRMTERAQDFYVSLGMPKL
PDSYWNKTQFIKPRDRDVVCHASAWDMNMGGDVRTKMCIKPNEEDFTTIYHELGHVYYYL
AYNKQPPLFQTGAHDGFHEAIGDTIVLAMTPKYLSSIGMVGSQQQSNEALINAQMRMALA
KVSFLPFGLMIDRWRWGVFDGSIKPDGYNKAWWELKAKYQGVAPVEARGEEFFDAGAKYH
VPGNTPYTRYFLSHILQFQFYKSLCDAAGYKGPLYECSFYGNKAAGAKFEAMLSKGASQP
WQQTMKELTGGEKMDASAVLEYFAPLQTWLKQQNEGKSCGWQASAAGAAAPVSPAKPAKA
DAKPGKPVQG
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
ttgttggcgctcggcgtcgctgcggccgtgatcggcgtggccggctgcaagaaggaaccc
gtcccctcctcgagcaccaccgccccggccgtcgcgcccgcgggcgaaaccgcggatcag
ttcatcgctcgcgtcaacgacgagtacaagaagatgtatccggagatgaccgccgcgcag
tggctgtcgtcgacgtacatcaacgacgacagccagttgctgtcggccaaggccaacgaa
cgctatctgacccagctcaacagctggatcgagcagtcgaagaaattcgaaggccagcag
atgtcgccggccaccgcgcgttcgatccagttgctgaagatcggcaccgcgatgccggcg
ccgaaagatccggcgcggctcgccgaactcacccagatcgccacgcgcatggaaggcatg
tacggctcgggcagctactgcagcggccctggcgacaccgactgccgccagctcggcgac
cttgaagacgtgctgcgcaacagccgcgactacgacgcccagctcgacgcctggaagggc
tggcacaccatttccaagccgatgcgcaaggactacacgcgcttcgtcgaactggtcaac
gaaggcgcgaagaatctcggctacgccgacaccggcgaattgtggcgttcgggctacgac
atgagcccggtagaactggcggcggaaaccgatcgcctgtggggccaggtcaagccgctg
tacgagcaactgcactgctacacccgctcgcgccttgaatccaagtacggcaccgacaag
ggccaggccagcggcggcatgctgccggcgcatctgctcggcaacatgtggcagcaggac
tggggcaatttgtgggacgtgctggcgccgtacagcgatcagcaggccggcagcctcgac
atcaacggcgcgctggcgcgccagtaccagcagatcctcgacgcgcaggaagccaaggcc
ggcggcgatcgcggcccgctggagcaggcgcaggccgaggtcgatgccaacctggccaac
gccaagcgcatgaccgaacgcgcgcaggacttctacgtttcgctcggcatgcccaagctg
cccgacagctattggaacaagacccagttcatcaagccgcgcgatcgcgacgtggtctgc
cacgccagcgcctgggacatgaacatgggcggcgacgtgcgcacgaagatgtgcatcaag
ccgaacgaagaagacttcaccacgatctatcacgagctcggccacgtctattactacctg
gcttacaacaagcagccgccgttgttccagaccggcgcgcacgacggcttccacgaagcc
atcggcgacaccatcgtgctggcgatgacgcccaagtacctgtcctcgatcggcatggtc
ggcagccagcagcagagcaacgaggcgctgatcaacgcgcagatgcgcatggcgctggcc
aaggtctcgttcctgccgttcggcctgatgatcgatcgctggcgctggggcgtgttcgac
ggttcgatcaagcccgatggctacaacaaggcgtggtgggagctgaaggccaagtaccag
ggcgtggcgccggtcgaggcgcgcggcgaagagttcttcgacgccggcgccaagtaccac
gtgccgggcaatacgccgtacacgcgttacttcctctcgcatatcctgcagttccagttc
tacaagtcgctgtgcgacgcggccggctacaagggcccgctgtacgaatgcagcttctac
ggcaacaaggccgcgggcgcgaagttcgaggcgatgctgagcaagggcgcgagccagccg
tggcagcagaccatgaaggaactcaccggcggcgagaagatggacgcctcggcggtgctg
gaatacttcgcgccgctgcagacctggctcaagcagcagaacgaaggcaagagctgcggc
tggcaggcttcggcggcgggcgctgcggcgccggtttcgccggccaagcctgcgaaggcc
gatgccaagccgggtaagcctgtgcagggctga

DBGET integrated database retrieval system