KEGG   Linepithema humile (Argentine ant): 105668025Help
Entry
105668025         CDS       T04898                                 

Definition
(RefSeq) transmembrane protease serine 9-like
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
lhu  Linepithema humile (Argentine ant)
Brite
Enzymes [BR:lhu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     105668025
Peptidases [BR:lhu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   105668025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 649 aa AA seqDB search
MLLRYVLRYKLLILILIITFYLSIPIKGYGLRQESIITSISSIGNSSGNSQTRIGRFLFD
ELFGIDIVNAADISDEEKLRNCTCECGLFNQENRIVGGRPTIPNRYPWVARIVYDGRFHC
GASLLNNDYVITAAHCVRRLKRSKIRIVLGDYNQYVNTDGVPIMRAVSVVIRHKNFDINS
YNHDVALLKLRKSVEFSKKVRPVCLPQPGSDPAGKEGTVVGWGRTMEGGMLPGEMQEIQV
PIYSLAQCRKMKYRANRITDNMICAGRSNQDSCQGDSGGPLLVQEADKLEIAGIVSWGVG
CGRAGYPGVYTRVSRYLNWIHANMKEGCFCSSVRKKINIRSPNMKSLCYLGLLFILLLIT
EKCQAEKFDEKTKNFFGLFGNKPPYSNDSPSPCYCSCGLRNEESRIVGGQTTSMNEFPWM
ARLSYLNKFYCGGTLINDRYVLTAAHCVKGLIFRFMWFMIKVTFGEHDRCIEKGAETRYV
VRVMTGDFSFLNFDNDIALLRLNERVPLSDTIRPICLPSVYDNEYVGVNAIAAGWGTLQE
EGKPSCLLQEVEVPVMSLQACRNTSYSPRMISDNMLCAGYLEGKKDSCQGDSGGPLIAER
EDKKYELIGVVSWGNGCARPGYPGVYTRVTRYMDWILKNSKDGCFCEHN
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgcttttacgctatgtgttacgctacaagctcttaatcttgattttgattataaccttt
tatctatcgataccaatcaaaggctatggacttcgtcaagaaagtataataacatcaata
agttctattggaaattcttcaggtaattctcaaactcgtatcggaagattcttatttgat
gaactattcggtatcgatattgtcaatgctgctgatatcagtgacgaagaaaaactaaga
aactgcacatgcgaatgcggcttgtttaatcaagagaatagaattgttggtggacgtcct
acaataccgaacaggtatccttgggttgcgaggattgtgtacgacggtcgtttccactgt
ggtgctagtctactcaacaatgattatgtaattactgctgcacattgtgtacgaagattg
aaacgatcgaagattcgtatagtactcggcgattacaatcagtatgttaatactgatgga
gttcctattatgagagcagtgagtgttgtgatacgtcataagaattttgatataaattct
tacaatcacgatgtggccttattaaaattacgcaaatcggtggaattctcaaagaaagtt
cgcccggtctgtttacctcaaccaggaagcgatcctgccgggaaggaagggacagtggtg
gggtggggtcgaacaatggaaggaggcatgttgcctggagaaatgcaggagatacaagtg
ccaatatacagtttggcacaatgtcgaaagatgaaataccgagcaaatcgaattaccgat
aatatgatttgcgccggccgaagtaatcaggactcttgccaaggagatagcggcggtcct
ttgctcgtccaggaagccgataaacttgaaatagcaggtatagtttcgtggggtgttggc
tgcggtagagctggttatcccggagtttacacgagagtgtcccgatatctcaattggatt
cacgcaaacatgaaagaaggctgtttttgctcatcggtgcgcaaaaaaatcaatatcaga
tcgccgaacatgaagtctctgtgttacctaggtttattatttattctgcttttgataacg
gaaaaatgtcaggctgagaaattcgacgagaaaacaaaaaactttttcggactttttggt
aataaaccaccttactctaatgactcaccttcgccctgctattgcagttgtggattacgg
aatgaagaaagtcgtatagttggaggtcaaacgacgagtatgaatgagtttccatggatg
gctagattatcgtatttaaacaaattttattgcggtggtactcttataaacgatcgctac
gtgctcacagctgcacactgcgtcaagggtcttattttcagatttatgtggtttatgatc
aaagtcactttcggggagcatgatagatgtatcgaaaaaggagcggaaaccagatatgtg
gtacgtgtcatgaccggtgactttagctttctgaatttcgacaacgatatcgcattactt
cgcctcaatgagagagtgccattgagcgatacgatacggccaatatgcttgccatcggtg
tatgataacgagtacgtaggagtaaatgcaatcgcagcagggtggggaacattgcaagag
gaaggaaaaccgtcttgtcttctccaagaagtcgaggttccagtcatgagtcttcaagct
tgtcgcaataccagttatagtccccgaatgatttctgacaacatgctatgcgctggctac
ttagaaggaaaaaaagactcatgtcagggagacagtggcggaccactgatagcggagcgc
gaggataagaaatacgagctcatcggtgttgtatcctggggcaacggatgcgcacgacct
ggatatccaggtgtatacacgagggttacacgatatatggattggatcttgaaaaattca
aaggatggatgtttttgcgaacataattga

DBGET integrated database retrieval system