KEGG   Linepithema humile (Argentine ant): 105668398Help
Entry
105668398         CDS       T04898                                 

Definition
(RefSeq) putative aldehyde dehydrogenase family 7 member A1 homolog
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00010  Glycolysis / Gluconeogenesis
lhu00053  Ascorbate and aldarate metabolism
lhu00071  Fatty acid degradation
lhu00260  Glycine, serine and threonine metabolism
lhu00280  Valine, leucine and isoleucine degradation
lhu00310  Lysine degradation
lhu00330  Arginine and proline metabolism
lhu00340  Histidine metabolism
lhu00380  Tryptophan metabolism
lhu00410  beta-Alanine metabolism
lhu00561  Glycerolipid metabolism
lhu00620  Pyruvate metabolism
lhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105668398
   00053 Ascorbate and aldarate metabolism
    105668398
   00620 Pyruvate metabolism
    105668398
  Lipid metabolism
   00071 Fatty acid degradation
    105668398
   00561 Glycerolipid metabolism
    105668398
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    105668398
   00280 Valine, leucine and isoleucine degradation
    105668398
   00310 Lysine degradation
    105668398
   00330 Arginine and proline metabolism
    105668398
   00340 Histidine metabolism
    105668398
   00380 Tryptophan metabolism
    105668398
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105668398
Enzymes [BR:lhu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     105668398
    1.2.1.8  betaine-aldehyde dehydrogenase
     105668398
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     105668398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 105668398
NCBI-ProteinID: XP_012216185
LinkDB All DBs
Position
Unknown
AA seq 530 aa AA seqDB search
MSRLLLRNSRCYVPRFQMTRYLVNDARYGFLKQLGITAENPGLYDGRWGGSGKLIESVSP
ATGKVIATIRESTPQEASNTITEARKAWPQWASIPVPARGDIVRQIGDELRRNLKPLGHL
VSLEMGKILPEGIGEVQEFIDICDYAVGLSRTLPGRLLPSERKNHVLLENWNPLGVVGVI
SAFNFPIAVYGWNSAIAMVCGNTIVWKGALSTPLVAVATTKIIASVLERNGIPGSVASLI
TGGPEVGETLVNDKRVPLISFTGSTNVGRQVALKVQQRFGKSLLELGGNNALIIAQDADL
EMAVRAAVFSCVGTAGQRCTSTRRLILHKKIKDEFLGKLKTAYKSVLERVGDPLDDGVLY
GPLHNQPAVDAYKAAIKKAVEAGGTIEFGGKQIERAGFYVEPTIISGLPVEAEVVQQETF
APIVYILEANSLEEAIDLNNGVEQGLSSSLFTKSIGNIFQWIGPHGSDCGIVNVNIGTSG
AEIGGAFGGEKATGGGRESGSDAWKHYMRRATITINHGNELPLAQGIKFE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtttgttactaagaaacagccgttgttacgttccccgattccagatgacgagg
tacttagtgaacgacgcgagatatggcttcctcaagcaattaggtatcaccgccgagaat
cccggactctacgacggacgatggggtggatctggcaagttgatagaatcggtgtcacca
gcgaccggcaaggtgatagcgacgatccgcgagtccacgccgcaggaggccagcaatact
ataacagaagcacgcaaagcctggccgcaatgggcttctatcccggtgccggcgagagga
gatatcgtgcggcagataggcgatgagctcagaagaaacttgaagccgctgggacattta
gtatctttggaaatgggaaaaatattgccggagggcataggcgaggttcaggaattcatc
gacatatgcgattacgcggtgggattgtcgcgaacgttgccgggaaggctgttgccgtcg
gagagaaaaaaccacgtgctcctggaaaactggaatcccctgggcgtagtcggcgtcatt
tccgcctttaactttcccatagcggtctacggctggaacagcgctatcgccatggtctgc
ggcaacaccatcgtctggaaaggggcgctgagcacaccattagtggccgtcgcaaccacc
aagataatcgcgagtgtcctggagcgcaacggtatcccgggctccgtcgcgtccctcatc
accggcgggccggaagtcggtgagactctggtgaacgacaaacgggtacctctgatttcg
ttcaccggaagcacgaacgtgggaagacaagtggctctcaaggttcagcaaagatttgga
aagtctctgctggagcttggcggtaacaacgcgctgataatcgcacaggacgccgattta
gaaatggcggtgagagcagcggtcttctcgtgcgtcggaacagccggacaaagatgcacc
tcaactagaagattaatattgcacaaaaaaataaaggatgagtttttaggaaaattgaaa
acggcgtataagagtgtattggaacgagtcggagatccgctggacgacggtgtgctctac
ggaccgttgcacaatcaaccagcggttgacgcttataaggcagcaattaaaaaagctgtg
gaagccggtggcacgatagagttcggcggaaaacagatagagcgagcgggtttctacgtc
gagccgacgatcatttcgggtttgccggttgaagccgaagtggtgcagcaggagactttc
gctccgatcgtttacattctggaggcgaactctctcgaagaagctatcgatcttaacaac
ggcgtggaacaaggattgagcagtagtctctttactaaaagtatcggaaatatatttcag
tggatcggccctcacggatcagattgcggaatagtcaacgtcaacatcggcactagcggc
gccgagataggcggtgcgtttggcggtgaaaaggccactggcgggggccgcgaaagcgga
agcgatgcgtggaaacattacatgcgacgtgcgacgatcacgatcaatcacggaaacgag
cttcctcttgctcagggaatcaagttcgaataa

DBGET integrated database retrieval system