KEGG   Linepithema humile (Argentine ant): 105672756Help
Entry
105672756         CDS       T04898                                 

Definition
(RefSeq) histone-lysine N-methyltransferase Suv4-20 isoform X1
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:lhu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105672756
Enzymes [BR:lhu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105672756
Chromosome [BR:lhu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105672756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1196 aa AA seqDB search
MGLVRPQVQVRESQCHRMVVDCLSIQASATAVRKQERRLGGTVSTKMQPNSGGGCGMTPK
ELSDNDDLATSLVLDPYLGFTTHKMNIRYRPLKANKDELRKIICEFIQTQNYEKAYKKLM
GGDWGARLPHTKSKQQQINLENHIKRYLRVFDKDSGFAIEPCYRYSLEGQKGAKICATRK
WMKHEKISCLVGCIAELSEKEEAALLHPGKNDFSVMFSCRKNCAQLWLGPAAYINHDCRA
NCKFVATGRDTACVKVLRDIEVGEEITCFYGEDFFGDGNCYCECETCERRGTGAFASQKP
GEEMSSGISNAKFGATNYESRFIVNYFLGYRLRETDNRINRTKHRQQPLNRNKQQADTAL
TERNAVLVGNAAVAPQSLSMKELRRKGLTKYDAELLIAQGCRFSDINQQQPAINNGENVL
QTRPHPSAITTSVTRNLRNKQMCKFDGNIGDGGTIKNTQSLRSSRLYKRTESKKGKIGVK
SASPCPIVKDTEMMDISHRKEDSDRVPVHEESLYSRLQKHHSSLASQVNRGFCGSQRPAV
TEESSMENSCPLRLMEVDDISESNNNGDSAEEERGIPDLTAEVELKAVDNVNSSNYKKGH
YSTNACDSIRLSSTSQVHIQRLHTAESISKDICRSRDYHHSSSPMRNKENENDPCDTVEQ
ANCVNKRSKSNGKRFTSMDERDDRKEPDEDSSGEFEDDDSPSLIEEKKDLRQADYREDDA
SHETSSRSDDEYCDINSANVMTMEKYDEEKEVESEGCENSIAADATTNRLDSVEYCDLNS
EGVVETKISTEDVLEWHNSMVAHREEEEESVVMKSDTFVANVRFDAKSEVSALHAMEMDS
RVDVTEESGVANFHNIQTANYNSDLTGHRNVEDGHDHALMKKSSRRKDHALDASSKSSRK
SQKRLSSGKSKSKYGILTEGDENDSGGTKSHKTGKSKNKSTRSQRRDRQRSATADIGEAD
DDSGIQGDIYEFNEKESNLEDIGILSIIRRGKHESRNASSSVTASPVQEMQCNDEYNKAE
PPVLIREEPWPPADPGTQNEHSTDSSSGVQSAENCDESLQRLTAYDNSGSTRKSSSTPSE
CQWQTSNSSDCRVCPVTPERTGRLKLTLRMKRSPVLEDIAESGTSGLSEDSYEPEYEVLR
VEGLERRKRRKKHKSRDRERRHKKSRELNLDPPPPPMKRLRLILGNETRTIDLTHS
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
atgggtttggttcgtcctcaggtgcaggttcgtgaaagtcagtgtcacagaatggtggtg
gactgcttgtcgattcaggcctcagcaactgcagtaagaaagcaggagcgaaggttgggt
ggcacggttagcacaaagatgcaaccaaacagtggtggaggatgtggaatgacacccaaa
gaactctccgacaatgacgacttggccacgtccctcgtattagatccttacctaggcttt
actacacataaaatgaatattagatacagaccgttaaaggcaaataaggatgaactgcga
aaaattatctgtgaatttattcaaactcaaaattatgaaaaagcatacaaaaaattgatg
ggtggagattggggcgcgcggcttccccatactaaatctaaacaacaacaaatcaatttg
gaaaatcacatcaaacgatacttgcgagttttcgataaggattctggatttgcgatagaa
ccatgctacagatacagtttggagggacaaaagggtgctaagatatgtgccacccgaaaa
tggatgaaacacgagaaaatttcctgcctcgtcggttgcatagcggagcttagtgaaaag
gaagaagctgcgttattgcatcctgggaaaaatgacttctctgtgatgtttagttgtcga
aagaactgcgcccaattgtggttaggacctgctgcatatataaatcatgactgtagagcg
aattgcaagtttgtggcgacgggaagagacacagcatgtgtcaaagtgttacgcgacatc
gaagtaggcgaagaaatcacatgcttctacggagaggatttctttggtgatgggaattgt
tactgcgagtgtgaaacttgtgaaaggcgaggaactggcgcatttgcgagtcaaaagccg
ggcgaggaaatgtcatctggtatttcaaacgcgaaatttggagcaacaaattatgagtca
agatttatcgttaattattttttaggatatcgtttgagggaaacggataatcgaatcaat
cgaacaaaacatcgacagcagccgttgaacagaaacaagcagcaagccgacactgctctc
accgagcggaacgcagttctcgtcggaaacgcagcggttgcgccgcaatctcttagcatg
aaggagctgcgtcgcaaagggctcaccaagtacgacgccgagctactgatcgcccagggt
tgccgcttctcggatatcaatcagcagcagccggcgatcaataatggcgagaacgtgttg
cagacacgaccgcatccctccgcgatcaccacctccgtcactagaaatttgcggaataag
cagatgtgtaaattcgacggcaatatcggcgacggaggcaccatcaagaatactcagtcg
ctcagatcatctaggctttacaagagaacggaatcaaagaaaggaaagatcggtgtgaaa
tccgcgtcaccttgtcctatcgtaaaggacacggaaatgatggatatcagtcatcgaaaa
gaggattccgacagagtgccggtgcacgaagaaagcctgtactcgcgattgcagaagcat
cattcgtcgctggcgtcgcaggtgaatcgcggtttttgtggatcgcaacggcctgctgtg
acggaagagtcctcgatggaaaacagctgtccgctgcggttgatggaagtggacgatatc
agcgagtcgaacaataatggtgattcggcggaagaggaacggggaataccggatctcacc
gcggaagtcgaacttaaagcagtagataacgttaattcttccaattacaaaaaaggacat
tatagtacaaatgcctgtgattcaatccgattaagttccacatctcaagtccacatacaa
cgcttacataccgcagaatcgatttccaaggacatttgtcgatcgagagactatcatcat
tcttcgtcgcccatgcgaaataaggaaaacgagaatgatccctgcgatacggtcgagcag
gcgaattgtgttaacaaacgttccaagtctaacggcaaacgtttcacgtcgatggacgag
cgagatgatcgcaaagagccagacgaggactcgtctggcgagtttgaggacgacgattcg
ccctcgctgatcgaagagaagaaagatttgcggcaggctgattaccgagaggatgacgcc
tcgcacgagacgagctctcggtcggacgacgaatattgcgacataaactcggcaaatgta
atgacgatggaaaagtatgacgaggagaaagaagtggagagtgaaggctgcgagaattcg
attgcggccgatgcgacgacaaatcgcctggacagtgtcgaatattgtgatttaaactcc
gaaggagtagtagagacaaaaattagtaccgaggatgttctagagtggcataatagcatg
gttgcgcatcgggaagaagaggaggagagcgtcgtgatgaaaagtgatacgtttgtcgca
aacgtcaggttcgacgccaaatctgaagtttccgcgttacacgcgatggagatggactcc
agagtagacgttaccgaggaaagtggtgtggcgaactttcataatatacagactgcgaat
tacaatagcgatttaaccggccatagaaatgtagaagacggtcacgatcacgcgttgatg
aagaaatcgtccagacggaaagatcatgcactggatgcgtcttcgaagtcgtctcgcaag
tcgcagaagagactttcgagcggtaaatccaagtccaaatacgggatattgacggagggc
gatgagaatgacagcgggggtacgaagagtcataaaacgggaaagagtaaaaataaatcg
accagaagtcagaggagagaccggcagagatcggcgacggccgatataggagaggccgac
gacgattcgggcatccagggcgatatctatgagtttaacgagaaggagagcaacttggag
gacattggcatactgtccataataagacgcggcaagcacgaatctcgtaacgcgtcgtcg
tccgttactgcgtcgccggtgcaggaaatgcagtgcaatgacgagtacaataaagccgag
ccaccggtactgattcgggaggaaccgtggcctccggccgatccggggactcagaacgaa
cacagcacggactccagtagcggtgttcaatcggcagagaactgtgacgagagtttgcaa
agattaacagcctatgataatagtggcagcacacgaaagtccagctcgaccccatccgag
tgccaatggcaaacgagcaattcgagcgattgtcgcgtttgccccgtcacgccggagagg
accggccgattgaagctgacgctgcgcatgaagcggtcgccggtgctcgaggacattgcc
gaatccggcacaagcggactgagcgaagacagttacgagccggagtacgaggtgctgcgc
gtcgaaggcttggagaggcgcaaacgccggaagaagcacaagagtagagatcgcgagaga
cggcataagaaatcgcgcgagctgaacctcgatccgccaccgccgcccatgaagagatta
cgcttgattctcggcaacgagacacgcactatcgatctaacgcactcttaa

DBGET integrated database retrieval system