KEGG   Linepithema humile (Argentine ant): 105673077Help
Entry
105673077         CDS       T04898                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial isoform X1
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lhu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    105673077
   00650 Butanoate metabolism
    105673077
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105673077
   00280 Valine, leucine and isoleucine degradation
    105673077
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105673077
Enzymes [BR:lhu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     105673077
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     105673077
Amino acid related enzymes [BR:lhu01007]
 Aminotransferase (transaminase)
  Class III
   105673077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 497 aa AA seqDB search
MFVNKCHHVLSTRTSTRRLLKGVTTWKRCLTTGSREPEGPVVATEIPGPRSRSLLQELNS
IQQASSVQFFADYEKSSGNYIMDVDGNALLDVYMQISSMPLGYNHPAMLEALADPVNQKI
IANRPALGVFPAKDWPNRLKNVLLEKEVAPPGLSHITTMMCGSCSNENAFKNIFIWYAEK
QRQGAPFTKEEIESCMINEKPGSPHYSIMSFKGAFHGRTLGCLSTTHSKYIHKMDIPAFD
WPIASFPEYKYPLEENVRENQQEDKRCIAEVEELFERYKNEKRMPVAGVIIEPIQAEGGD
NHASSEFFQELQRVTRKHGAALLIDEVQTGGGPTGKMWCHEHFNLSTPPDVMTFSKKMQL
GGYYHLEDFKPKQGYRVFNTWMGDPSKVILLEAILEIIKKENLLDRVTRVGDYMLKNLKD
LQNEHSNTINAVRGRGTFIAFNCASSQLRDAIVKKLLTKGIQAGGCGSQAVRLRPALTFT
ERHADIFFDALRSVLKE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttaacaagtgccatcacgtgctgagcacgcggacctcaactcggcggctacta
aaaggcgttacaacgtggaaaagatgcttaacaaccggttcgagggaacctgaagggcca
gtggttgcgacggaaatacccggccctcggtcgcgtagtttgctgcaggaattaaattcg
atacaacaagcgtcgtccgtacagtttttcgcagactacgagaaatcttccggtaattac
ataatggacgtcgatgggaatgcactgctggacgtttacatgcaaatctcgtcgatgcct
ctaggctataatcatccggcgatgctggaggcgctcgccgatcccgttaatcaaaaaatt
atagcgaatagaccagcattgggtgtctttcctgcgaaagactggcccaacagattgaag
aatgttctgctcgaaaaagaggtcgccccgcctggattatcgcacatcacgacaatgatg
tgcggctcttgttccaatgagaacgcttttaaaaacatttttatttggtacgctgagaaa
caacggcaaggagcaccgttcaccaaagaagaaatagaatcgtgcatgataaatgagaaa
cccggctcgccgcattattccatcatgtcttttaaaggtgcttttcacggaagaacatta
ggttgtctctcaacaactcacagcaagtacattcataagatggatataccagctttcgac
tggcctattgcctccttcccagagtacaaatatcctttggaggagaacgtgcgagaaaat
caacaggaagataagcgttgcatcgcggaggtggaagagttgtttgaaaggtacaaaaac
gagaaaaggatgccggtggccggtgtgataatcgagcccatacaagcagaaggtggcgac
aatcacgcgtcgtcagaattctttcaggaacttcaacgtgtaacgcgaaagcacggcgct
gcgttacttatcgacgaagtgcagactggtggcgggccgacgggaaaaatgtggtgccac
gagcacttcaatttaagtactccgcccgacgtgatgaccttcagcaagaaaatgcaactg
ggcggttattatcacttggaagatttcaagccaaagcaggggtatcgtgtgttcaatacg
tggatgggcgaccccagcaaggtaatactgctcgaagcaatcctggaaataatcaagaag
gagaatcttttagatagagtcacgcgcgttggcgattacatgttgaaaaatttgaaggat
ttacaaaatgaacattccaatacgatcaacgcagtgcgcggtcgtggaactttcatagcg
tttaattgtgcttcgtctcaattgcgagacgccatcgtcaagaaattgttaactaaaggc
attcaagcaggtggatgcggcagtcaggctgtgcgactcaggcctgcgttgaccttcacg
gagcgtcatgctgatatatttttcgacgcgctccgctctgtgctaaaggaataa

DBGET integrated database retrieval system