KEGG   Linepithema humile (Argentine ant): 105673679Help
Entry
105673679         CDS       T04898                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial isoform X1
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:lhu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    105673679
Enzymes [BR:lhu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     105673679
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 718 aa AA seqDB search
MSLRLLVAGASAVGAGTLTSYFLLSDTTVHAEKGKPRPPRRTLPTREDQVKTLKSQDYDV
LIIGGGATGAGCALDACTRGLKTALVEADDFASGTSSRSTKLIHGGVRYLQKAIMQLDVE
QYRMVKEALHERASMLQSAPHLAHPLPIMLPVYTWWQIPYYWFGIKMYDLVAGSKTVKSS
YYLSKSNALELFPMLKGDKLTGAIVYYDGQQDDARMNLAVALTASRHGATVVNHVKVVNL
LKGLDKDGKRVLVGAHLRDELTGEEWDVKAKAIINATGPFTDHIRKMDDQNVKSICCPSS
GVHIVLPGYYSPDQMGLLDPATSDGRVIFFLPWQKQTIAGTTDLPCEVTHNPRPTEDEIM
FILQEVKNYLNPDVEVRRGDVLSAWSGIRPLVSDPNKPNTQSLARNHIVHVSPTNLITIA
GGKWTTYRAMAQETIDAAIKACDLEPERPCQTDGFLLEGAQGWSPTMYIRLVQDFGLECE
VAQHLSKSYGDRAFAVAKMASLTGKRWPIIGKKIHPEFPYIDAEIRYGVREYARTTIDMI
ARRLRLAFLNVQAAQEALPVIIDIMAEELHWSAEEKKKQYREASDFLAQEMGQMVNRASR
DKIPINLTKDEIQLYIKRFRIIDKDKKGYVSINDIRRGLKLFGDKEVPGEELHEILREID
TNMNGQVELDEYLQMMSAIKSGHVAYSRFARMAEMEEAQHEKEMLKKQISVERSGGGL
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcagattacttgtagcaggagcgagtgccgtgggtgccggtactctcacttcc
tattttctcttatcagatactacagtgcacgccgaaaagggaaaaccaagaccacctcga
agaactttacccacacgggaggatcaagtaaaaactttgaagtcacaagactatgatgta
ttgataattggaggtggtgcgacaggagcaggatgtgctctagacgcttgcacacgaggt
ttaaagacggcgttagtcgaagcagacgattttgcatctggtacttcttctcgaagcaca
aaattaatccacggtggcgtacgatacttgcagaaagcgattatgcagttagacgtcgaa
cagtacagaatggtaaaagaggcacttcacgaacgtgcctcgatgctgcaaagtgcaccg
catctggcgcatccgttgcccattatgctaccagtttatacatggtggcagattccttat
tactggttcggcattaagatgtacgatctcgtagcaggtagcaaaacggtcaaatcgtca
tactatctaagtaaatcaaacgctttggaactttttcctatgctgaaaggcgacaaattg
acaggcgctattgtctattatgatggccaacaagacgatgctaggatgaatttggcagtt
gctttgacagcttcgagacacggggccacagttgtaaatcatgttaaagtggtcaacttg
ttaaaaggtcttgataaggatggcaagcgagtcctcgtaggagctcatcttagagacgag
cttacaggagaagaatgggatgtgaaggctaaagcaataattaacgccaccggccccttc
actgatcacatcagaaaaatggacgaccagaatgttaagtctatttgctgtccgtcttcc
ggagttcacatagtattgccaggttattacagtcccgatcagatgggtttactcgatcca
gcgacgagcgatggccgagtgatcttctttctgccttggcaaaagcaaactatcgcggga
acaaccgatttaccgtgcgaagtaacgcataatcctcggcccacggaagacgagatcatg
tttatcctgcaggaagtgaaaaactatctcaatccggacgtcgaggtacgccgtggagat
gttctctccgcctggagcggtattaggccgctcgtttccgatccgaacaaaccgaacaca
cagtcgcttgccagaaatcacattgtgcatgttagtcctacgaatctcatcacaatagca
ggcggcaagtggacgacttaccgagcaatggctcaagaaaccattgacgcagccataaaa
gcttgcgatttggaaccagaaagaccttgccaaactgacggctttcttctggaaggtgct
caaggctggagccctacgatgtacatcagattggtgcaagatttcggcttggaatgtgaa
gtcgcgcaacatttgtccaagagctacggagatcgtgcatttgccgtagctaaaatggct
tccctcacgggaaaacggtggccaattattgggaaaaaaattcatccggaatttccgtac
atcgacgctgaaatacgctatggtgtacgagaatacgctagaactacaatcgacatgatc
gcgcgtcgattaagactcgcttttcttaacgtgcaagcggctcaagaggcattgccagtc
atcatagatattatggccgaggaactgcattggtcagcagaggagaaaaaaaaacaatat
cgcgaagccagtgactttctcgctcaagaaatgggccaaatggtgaatcgtgcttctcgt
gacaaaattcccatcaatcttaccaaggatgagattcaactttacattaagcgcttcaga
atcatagataaggataaaaagggatatgtatctatcaatgatattagacgagggctgaag
ctctttggagataaggaagtaccgggtgaagaacttcacgaaattctacgcgaaatcgac
accaatatgaacggtcaagttgaattggatgaatatcttcagatgatgtcagctataaaa
tctggtcatgtggcatattcacgttttgcacgcatggctgaaatggaggaagcgcaacat
gaaaaggaaatgctcaagaaacaaataagtgttgaaagatccggtggaggattgtaa

DBGET integrated database retrieval system