KEGG   Linepithema humile (Argentine ant): 105679941Help
Entry
105679941         CDS       T04898                                 

Definition
(RefSeq) histone-lysine N-methyltransferase NSD2 isoform X1
  KO
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:lhu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105679941
Enzymes [BR:lhu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105679941
Chromosome [BR:lhu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105679941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1207 aa AA seqDB search
MNTVSIEANKNSKISKTQEEFVDENNISEKMDKVSCSSTASNNVEEILSPKINHSSNHNT
ECHWVIGQLAWARVGNFPFWPCIVTLDPVSMIYHKLKVMSKSTILLVHVQYFGDNERHSW
VSSNSMISFTNLDDFVKLPESLTAEQKKQNAKYIRAFVIKQGTKAKWDKAVEEAMEVQSM
TIEERAEAFAPKKKVSKSKVTLKSSSNDQKNKNKRKNSTDQDRPDTKRTKYDNIYNAGKL
DTPKSKNLRTSNDKAALKLNLDSLPSSPSSSKSSHESTNTKIDKGEEDLEGLFEIYYLRN
RDFLEEEYPDASEQEIKKYLRKTWNDMDKSYRKKYRSYMTNDGNLPSKESSPNREEIFAD
IEMSIKENKKTKNKIDKEESSVSEMKRGRPYNLFKGLKQEKVCQICEKAGKLTRCKGPCY
SYFHLSCVKPGESSPEHSADENTSDDKILDDLNIIKKSINSENKNDKSEEQEDETFKCID
CLSGVAPACFICNEREGDRIRCIVPACGKHYHSKCLNSWPQSHWQGGRLTCPYHVCHTCS
SDNPQDNHSRAPNEKMARCVRCPSSYHASIKCLPAGSTILTASQIVCPKHYKAPNPPSNA
AWCFLCSRGGSLICCDTCPTSFHLECLGIDAPDGGFICEDCETGRLPLYGEVVWVKFGHY
RWWPSRICYPQEIPEKVDALSHSPGKFCVMFLGSHNYYWVHRGRAFLYQDGDANFKPPIG
KKNGMDDRFRAALLEANRLHQQLKSQRSVTKEPKGLKPPPYVKLKVNKPVGNVKPAEVES
IVACECNPDLDNPCAPGTDCLNRILLVECSPGICPAGPKCMNQSFVLRQYPAMEPFHTVG
RGWGLRTLEDIQAGQFVIEYVGEVIDEAEYRCRLYRKKELKNENFYFLTIDNNRTIDAEP
KGNLSRFMNHSCAPNCETQKWTVNGDTRIGLFALRDIESSEELTFNYNLASDGETHKQCL
CGAPNCSGFIGLKVQKQQPKKDDKPKRRWRKKLICWRCGQKISDSSKFIICSQTTCKKKY
HMTCVEVDEAEPKFSCPWHYCLECGRRTSSHCSFCSTAFCQVHLDGNLFERENDKSGVVC
KSHENADTPKPTGDEKEYSDNDNETDKEYSSTSSSSPIVMEKIATREPSPRVSIVEVHLS
SEESEGSQKEEEENNLEINFMSCDKSSRASVKKNTLHKSQREGNKTKDLSNLTSSQLEAI
IGGSLNE
NT seq 3624 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgtgagcatagaagccaacaagaattcaaaaatatcgaagactcaagaggag
tttgtcgatgaaaataatatatctgaaaagatggataaagtcagttgttcttctactgct
tctaataacgtagaagaaattttgtctcctaagataaaccattcaagtaatcacaatact
gaatgccattgggtaataggacagttagcatgggccagggttggcaatttcccattttgg
ccttgtattgtgacacttgatccagtctcaatgatatatcacaagcttaaagttatgagc
aaatcaactatcttgttggtacatgttcagtactttggagacaatgaacgtcatagctgg
gtttcatcaaattctatgatatcatttacaaatcttgatgactttgtaaaactaccagaa
tcactaacagcagaacaaaaaaagcaaaatgctaaatacattagggcttttgttataaag
cagggaacaaaggcaaaatgggataaagcagttgaagaagcaatggaagtacagtcaatg
acaattgaagaaagagctgaagcttttgcaccaaaaaagaaagtttcaaagtctaaagta
actttaaagtcatcttctaatgatcaaaaaaataaaaacaagagaaaaaattcgactgat
caagatagacctgatactaagcgcactaaatatgataatatatataatgcaggaaaattg
gatacgccaaaatcaaaaaatttgcggacttctaacgataaagctgctttaaaactaaat
ttagattctttaccttcatctccttcaagttctaaaagttctcatgaaagtacaaataca
aaaattgataaaggtgaagaagatctagaaggtttatttgaaatctattatttaagaaat
agagattttctggaggaagaatatccagatgcatcagagcaagaaataaaaaaatatttg
cgaaaaacttggaatgacatggataaaagttatcgaaagaaatatcgatcgtatatgacc
aatgatggtaatttaccttcaaaggaaagttctccaaatcgtgaagaaatatttgctgat
attgaaatgagtattaaggaaaataaaaaaacaaaaaataagattgacaaagaagaaagt
tctgtttcagagatgaaacgaggtaggccatacaatctctttaaaggtttgaagcaagag
aaagtttgtcagatttgcgagaaggcaggcaagttaacgagatgtaaaggaccttgttat
tcttattttcatttatcctgtgtgaaacctggcgaatctagtccagaacactctgctgat
gagaacacatcagatgataaaatacttgacgatttaaatataattaaaaaaagtattaat
agtgaaaataaaaatgataaatccgaggaacaagaagacgaaacatttaaatgtattgac
tgcttatctggagtagcacctgcttgttttatatgcaacgaaagagaaggagatagaata
agatgtattgtgccagcttgtggaaagcattatcattccaagtgtttgaattcgtggcct
cagtcacattggcaaggtggacgtttgacgtgtccgtatcatgtatgtcacacatgtagt
tccgataatcctcaagacaatcactcgcgcgctcctaacgagaaaatggcaagatgcgtc
cgttgtccttcatcttatcacgcgtccatcaagtgtcttcctgccggctcgacaattttg
acggccagtcaaatcgtatgtcctaagcattacaaagcgccaaatcctccatcaaatgcg
gcatggtgtttcttgtgttcacgaggcggcagcttgatttgttgcgacacgtgtccgact
tcatttcatttggaatgtctcggcatagatgcacctgacggtggatttatttgtgaagat
tgcgaaacaggaagattacccttgtacggagaagttgtgtgggtgaaattcggccattat
cgatggtggccgtctcgtatatgttatccgcaagaaatacctgaaaaagtagatgcttta
tctcatagccctggtaaattttgcgtaatgtttttgggatctcataattattattgggtg
catagaggtcgagcttttttgtatcaagatggcgacgcaaattttaaaccacctataggt
aaaaagaatggtatggatgacagatttcgagcagccctgctagaagcaaatagattgcat
caacaattaaaatcgcagcgatccgtgactaaggaaccaaaaggattgaaaccaccacca
tatgtaaaattaaaagtcaataaaccagtgggtaacgtgaagccagccgaagtcgagagc
attgtggcgtgcgaatgcaatcctgatttggataatccatgcgcacctggaacagattgc
ttgaatcgtatattgttggtcgagtgcagtccgggaatctgtccggctgggcccaaatgt
atgaatcaatcgtttgtgttgcgacaatatccagcgatggagccatttcacacggtgggt
cgcggctggggtttacgaactttggaggacattcaagccggacaattcgtcattgagtat
gtgggagaagttatagacgaggctgagtataggtgtagattgtatcgaaaaaaggaacta
aaaaatgaaaatttttacttcttgacaatcgataataatagaacaatcgacgcggaaccg
aaaggaaatctaagccgatttatgaatcattcatgcgccccgaactgtgaaacgcagaaa
tggacagtaaatggcgatacgcgtatcggtttatttgctttgcgtgacatagaatcaagt
gaagagctgacgtttaattataatttagcgtcagatggagaaacgcataaacaatgtctt
tgcggtgcaccgaattgtagtggttttattggtctaaaagtacagaaacaacaaccaaag
aaagatgataagcctaaacgaagatggagaaaaaaacttatatgttggcgatgtgggcaa
aaaatatctgattctagtaaatttataatttgctcgcaaacaacatgtaaaaaaaagtat
catatgacgtgcgtggaagttgatgaggcggaaccaaaattcagttgtccttggcattat
tgtttagaatgcggtcgtcgtacatcttcacactgttctttctgcagcactgctttctgt
caagttcatctggatggaaacttattcgaacgagaaaacgacaaaagtggtgtcgtgtgt
aaatcacacgaaaatgcggatacaccaaaacccaccggagacgagaaagaatattcggat
aatgataacgagacagataaagagtattcctccacgagttccagtagtccgatcgtaatg
gaaaaaattgcgacgcgagaaccatcaccaagggtttctatcgtagaggttcatcttagc
agtgaagagagtgaaggatctcaaaaggaagaggaagaaaacaatctagagattaatttt
atgtcatgtgataaaagttcaagagcttcagtgaagaaaaacacacttcataaatcacag
agagaaggaaataaaacgaaggacttaagtaatcttacatctagtcagttagaagccata
attggcggtagcttgaatgaatga

DBGET integrated database retrieval system