KEGG   Listeria ivanovii subsp. londoniensis WSLC 30167: JL58_12115Help
Entry
JL58_12115        CDS       T03401                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
lia  Listeria ivanovii subsp. londoniensis WSLC 30167
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:lia00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    JL58_12115
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JL58_12115
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JL58_12115
   00430 Taurine and hypotaurine metabolism
    JL58_12115
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    JL58_12115
Enzymes [BR:lia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     JL58_12115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2512212..2513606
Genome map
AA seq 464 aa AA seqDB search
MLYSKENQESYLEPIFGSSAEDRDIPKYTLGKEPLEPRIAYQLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKEQKFMGTSTI
GSSEACMLGGMAMKFTWRNRAEKLGLDIHAKKPNLVISSGYQVCWEKFCVYWDIDMRIVP
MDKDHMQLNTDQVLDYIDEYTIGVVGILGITYTGRYDDIYALNEKIEQYNSQTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDENYLPKELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLANAVKQTG
YFDIYNDGSHLPIVCYKLKEDANISWTLYDLADRLQMRGWQVPAYPLPKSLENVIIQRYV
CRADLGFNMAEEFIQDFKASIHELNNAHILFHDKQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaatcaagaaagttatttagaacccatttttggatccagcgca
gaggatcgtgatattccaaaatatactctcggaaaagaacctttagaacctcgtatcgct
tatcaattagtgaaagatgaactattagatgaaggatctgctcgtcaaaatttagctact
ttttgccaaacatatatggaagacgaagctaccaaattaatgtccgaaaccttagaaaaa
aatgccattgataaatcggagtatccacgaacagcggaacttgaaaatcgctgcgttaat
attattgcagatttatggcacgcaccaaaagaacaaaaattcatggggacttctacaatt
ggctctagtgaagcttgtatgttaggtggaatggcgatgaaattcacttggcgaaatcgt
gcagaaaagctaggcctcgatattcatgccaaaaaaccaaaccttgtcatttcttccggt
taccaagtttgttgggaaaaattctgtgtttactgggatattgacatgcggatcgtacca
atggataaagaccatatgcaactaaataccgaccaagtgttagactatattgatgaatat
actatcggcgtcgtcggtatccttggtattacctacacgggacgttacgacgacatctac
gcccttaatgagaaaattgaacaatacaacagccaaacagattacaaagtatacatccac
gttgatgcagcaagcggaggtttctttaccccatttgtggaacctgacatcatttgggac
ttccgtttaaaaaatgttatttctattaacacttctggacataagtatgggttagtctat
cctggtattggctgggtgctttggaaggatgaaaactatttgccaaaagaactcattttc
aaagttagttatcttggcggagaaatgccaacaatgcaaatcaatttttctaggagcgct
agccatattatcggccaatattataatttcctacgctatggctttgaaggctaccggacc
attcatcaaaaaacaagtgatgttgcacaatatcttgcaaatgccgtaaaacaaactggt
tatttcgacatttataatgacggctcccatttgccaattgtctgctataaattaaaagaa
gatgcaaacattagttggacgctttacgatttagctgaccgcttgcaaatgcgcggatgg
caagtaccagcttatccactaccaaaaagtttagaaaacgttattattcaacgctatgtt
tgtcgagctgaccttggtttcaatatggctgaagaatttatccaagatttcaaagcttct
atccacgaactaaataacgcccacatccttttccatgataaacagcaatccggtgttcat
ggcttcacgcactaa

DBGET integrated database retrieval system