KEGG   Limnohabitans sp. 63ED37-2: L63ED372_00506Help
Entry
L63ED372_00506    CDS       T04121                                 

Gene name
cbbL
Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:lih00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    L63ED372_00506 (cbbL)
Enzymes [BR:lih01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     L63ED372_00506 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
533789..535210
Genome map
AA seq 473 aa AA seqDB search
MATKTYNAGVKEYRSTYWEPHYTPKDTDILACFKITPQAGVDREEVAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYAIEDVPGDDTCFYAFVAYPIDLFEEGSVVNVLTSLVGNVFGF
KALRALRLEDIRFPIAYIKTCGGPPHGIQVERDIMNKYGRPLLGCTIKPKLGLSGKNYGR
AVYECLRGGLDFTKDDENVNSQPFMRWRQRFDFVQEAIEKAERETGERKGHYLNVTAPTP
EEMYKRAEYAKEIGSPIIMHDYLTGGLTANTGLANWCRDNGMLLHIHRAMHAVLDRNPHH
GIHFRVLTKVLRLSGGDHLHSGTVVGKLEGDRASTLGWIDIMRDEFIKEDRSRGIFFDQD
FGSMPGVMPVASGGIHVWHMPALVNIFGDDSVLQFGGGTLGHPWGNAAGAAANRVALEAC
VKARNEGVAVEKEGKAVLSEAAKHSPELKIAMETWKEIKFEFDTVDKLDIAHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaaaacctacaacgccggtgtcaaggaataccgcagcacttactgggaaccc
cattacacgcccaaggacaccgacatcctggcctgtttcaagatcacaccccaagccggt
gtggatcgcgaagaagtcgctgcggccgtggccgctgaatcgtcaaccggcacttggacc
acggtgtggaccgacttgctcaccgacctggactactacaaaggccgcgcctacgccatc
gaagacgtgcccggtgatgacacctgtttttacgccttcgtggcctaccccatcgacctg
ttcgaagagggctcggtcgtcaacgtgctgacctctttggtcggtaacgtgttcggcttc
aaggctttgcgcgctctgcgtctggaagacatccgcttccccatcgcttacatcaagacc
tgcggcggcccaccccatggcatccaggtcgagcgcgacatcatgaacaaatacggtcgc
cccctcttgggttgcaccatcaaacccaagctgggtctgtcgggcaagaactacggccgc
gctgtgtacgaatgcctgcgcggtggtttggacttcaccaaagacgacgagaacgtcaat
agccagcccttcatgcggtggcgtcagcgatttgactttgtgcaagaagccattgaaaaa
gccgagcgcgaaaccggtgagcgcaaaggccactacctcaacgtgaccgcgcccaccccc
gaagagatgtacaagcgcgccgagtacgcgaaagaaatcggctcgccgatcatcatgcac
gactacctcaccggcggtctgaccgccaacaccggcttggccaactggtgccgcgacaac
ggcatgctgctccacatccaccgcgccatgcacgccgtgctcgaccgcaacccgcaccac
ggcatccacttccgtgtgctgaccaaggtgctgcgcctgtcgggtggtgatcacctgcac
tccggcactgtggtgggcaagctcgaaggcgaccgcgcctctaccttgggctggatcgac
atcatgcgcgacgagttcatcaaagaagaccgcagccgcggcatcttcttcgaccaagac
ttcggctctatgcctggcgtcatgcccgtggcctccggtggcatccacgtctggcacatg
cccgcactggtcaacatctttggtgacgactcggtcttgcagttcggtggtggcaccttg
ggtcacccatggggcaacgccgctggcgctgccgccaaccgtgtggccctggaagcctgc
gtcaaagcacgcaacgaaggcgtggccgttgaaaaagaaggcaaggctgtgctcagcgaa
gccgccaagcactcgcccgaactcaagatcgccatggaaacctggaaagagatcaagttc
gaattcgacaccgtcgacaagctcgacatcgcccacaagtaa

DBGET integrated database retrieval system