KEGG   Limnohabitans sp. 63ED37-2: L63ED372_02738Help
Entry
L63ED372_02738    CDS       T04121                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lih00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    L63ED372_02738
Enzymes [BR:lih01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     L63ED372_02738
Transporters [BR:lih02000]
 Other Transporters
  Pores ion channels [TC:1]
   L63ED372_02738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2882348..2882998
Genome map
AA seq 216 aa AA seqDB search
MLKLCGFAGSNYHNKVKLALLEKGVPFEEELAWVGETDPAASPLGKVPYFKTEDGAMCES
AVMLEYIEQKYPQNPLLPADPFAAAKVRELALFLDLHLELVARNLYPQAFFGGKVSDSVK
EKVGAQLEKNIAAFAKLAKFSPFVAGDTLTLADCAAVTHFPLVSGATKLVYGKDFLADLP
VRDYLKMMGERPHMQKVNADRKANMELMMARMKAKS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaactctgcggttttgcaggcagcaactaccacaacaaagtcaaactggccctg
ctcgaaaaaggcgtgccttttgaagaagaactggcctgggttggcgaaaccgaccctgcg
gccagccctttggggaaagtgccttatttcaaaaccgaagatggcgcgatgtgcgagtcg
gcggtgatgctggaatacatcgagcaaaagtacccacaaaaccccctgctgcctgcagac
ccctttgccgctgccaaggtgcgtgaattggcgctgtttctggacctgcacctggaactg
gtggcacgcaacctctacccgcaagccttttttggcggcaaggtgagcgactcggtgaaa
gaaaaagtcggggcgcagctcgagaaaaacatcgccgcttttgccaagctggccaagttc
tcgccttttgtggcgggcgacacactgaccttggccgattgcgcggccgtcacgcatttc
cctttggtctcgggcgccaccaagctggtctacgggaaagacttcctcgctgatctgcca
gtgcgcgattacctcaagatgatgggcgagcgcccccacatgcaaaaagtcaacgccgac
cgcaaagccaatatggaattgatgatggcccgcatgaaggccaaaagctga

DBGET integrated database retrieval system