KEGG   Listeria ivanovii subsp. ivanovii WSLC 3010: JL52_04260Help
Entry
JL52_04260        CDS       T03400                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lii  Listeria ivanovii subsp. ivanovii WSLC 3010
Pathway
lii00473  D-Alanine metabolism
lii00550  Peptidoglycan biosynthesis
lii01100  Metabolic pathways
lii01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lii00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    JL52_04260 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    JL52_04260 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    JL52_04260 (ddl)
Enzymes [BR:lii01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     JL52_04260 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:lii01011]
 Precursor biosynthesis
  Amino acid ligase
   JL52_04260 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AIS64814
LinkDB All DBs
Position
897005..898117
Genome map
AA seq 370 aa AA seqDB search
MKTKLILLYGGKSAEHEVSLQTAFSVINALDLNKFEAQPIYITNEGEWVQGPLLSGKLDF
VEQLRFAAADKVELALAETEKSAGELISPTVLEADGQETVVFPLLHGPNGEDGTVQGLFE
VLNIPYVGNGVLASSAAMDKIVMKKIFADAAIPQVPAVAVRLIDWKNFQDEMVTEMEEVL
EYPVFVKPANLGSSVGISKATNKQELTEAMTEAFLYDRRVVVEQGVVAREIEMGVLGNDT
PICSVPGEILPEGAVATFYDYKAKYQDNNTTLIIPTEVEPEILAQMKEYAIQAFLGLDAS
GLVRADFFLTDDNQLFLNEVNTMPGFTPYSMYPLLWQETGLPYPALIERLVDLAKERHAA
KNALKYKLED
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagttaattttattatacggtggaaaatccgcagaacatgaggtttcttta
caaacagcattttctgtaattaatgcactagatttaaataaatttgaagcacagccaata
tatattacaaatgaaggggaatgggtacaaggcccactcctttctggaaaattagacttt
gtggagcaattgcgttttgcggcagctgataaggtggaacttgctttagcagaaacggag
aagtcggcgggagaacttattagcccaactgttttagaagcagatggacaagagactgtt
gtgttcccattgttacatggaccgaacggagaagacggtacagtacaaggattatttgaa
gtattaaatatcccttatgttggtaatggtgtgcttgcttcatcggcggcaatggataaa
atcgttatgaaaaagatctttgcagatgcagcgattcctcaagttccagcagtagctgtt
cgtttgattgactggaagaactttcaagatgaaatggttaccgaaatggaagaagtgcta
gaatacccagtttttgttaaaccagcaaatcttggttctagtgttggtattagcaaggcg
accaataaacaagagctaacggaagcaatgactgaagcatttttatatgatcgtcgtgta
gtagtagagcaaggcgtagttgcccgtgaaatcgaaatgggcgttcttggaaatgatacg
ccaatttgttccgtgccaggtgaaattttgccagaaggagccgtggcaacattttatgat
tataaagcgaagtatcaagacaataatacgacgcttattatcccgacagaagtagaacca
gaaattctagcacaaatgaaagaatatgctattcaagcgttcttaggtttagatgctagt
ggacttgttcgcgctgatttctttttaacagatgataatcaattattcttaaatgaagtg
aacacgatgccagggtttacaccttatagtatgtatccacttttatggcaagaaaccgga
ttaccttatccggccctaattgaacgactagttgatctagcaaaagaacgtcacgcagca
aaaaatgcacttaaatataaattagaagactaa

DBGET integrated database retrieval system