KEGG   Limnohabitans sp. 103DPR2: L103DPR2_00337Help
Entry
L103DPR2_00337    CDS       T04120                                 

Gene name
dadX
Definition
(GenBank) Alanine racemase, catabolic
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
lim  Limnohabitans sp. 103DPR2
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lim00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    L103DPR2_00337 (dadX)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    L103DPR2_00337 (dadX)
Enzymes [BR:lim01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     L103DPR2_00337 (dadX)
Peptidoglycan biosynthesis and degradation proteins [BR:lim01011]
 Precursor biosynthesis
  Racemase
   L103DPR2_00337 (dadX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
386319..387437
Genome map
AA seq 372 aa AA seqDB search
MPRPIQATIDIQALRHNLSQIKAAAPDALVWGVVKANAYGHGIERVFEGLRAADGIALLD
LAEAERVRQLGWRGPVLLLEGVFETRDLELCSRLNLWHVVHCEAQIDMLAVHKTHQPHRV
FLKMNSGMNRLGFAPQAFRAAWTRLNALPQVDEISLMTHFSDADGEKGIAAAMSIFHQYT
HDLSGERSLCNSAASLRHAKDLAVRADWIRPGIALYGSSPDFPLHSAQDWGLKPVMSLNA
NIIAVQHLQAGDTVGYGSAFVADGPMRIGVVACGYADGYPRIAPTGTPVCVDGHRTRTLG
RVSMDMLTVDLTDLPHADVGSEVTLWGLPQKSTSQASSTTGVVIDEVAHAAGTVGYELMC
ALAARVPVVVKD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgccaagaccgattcaggccaccatcgacattcaagctttgcgccacaacctgtcgcaa
atcaaagccgcggcccccgatgcgctggtctggggcgtggtcaaggccaacgcctatggc
catggcatcgagcgtgttttcgagggtttgcgggcggctgacggcattgccttgctggat
ttggctgaggccgaacgcgttcgccaactgggttggcgtggacctgttctgttgctagaa
ggggtgtttgagacgcgtgatttggagttgtgttctcgattgaacctgtggcacgttgtg
cactgcgaagcgcaaatcgacatgctggcggtgcacaaaacccatcagccgcatcgggtc
tttctcaaaatgaacagtggcatgaaccgtttgggatttgcccctcaggccttccgggct
gcttggacgcgattgaatgcattgccgcaagtggatgaaatttcactgatgacacacttc
agtgacgccgacggtgaaaaaggcattgcagcggccatgtccatctttcaccaatacacc
catgatttgtctggcgaacgaagtttgtgcaacagcgcagcaagcttgcgccacgccaaa
gatttggctgtgcgcgcagactggatccgacctggcattgctttgtatggcagttcgccc
gatttccctttgcactcagcccaagactggggtttgaaacccgtcatgagtttgaatgcc
aacatcattgctgtgcaacatttgcaagcaggtgacacggtgggctatggctcggcattt
gtagccgacggcccaatgcgaattggcgtggtggcgtgtggttatgccgacggctatccg
cgcattgccccaacgggcactcccgtttgtgtggacggtcatcgtacgcgtacgctaggc
cgtgtcagcatggacatgctcacggtggacctcactgatttgccgcatgccgatgtgggc
agcgaagtgaccttgtggggcctgcctcaaaaaagcacatcccaagcaagttccacaacg
ggcgttgtcattgacgaagttgcgcatgcagccggtacggtaggctacgaattgatgtgt
gctttggcagcacgcgtgccagtggtggtcaaggattga

DBGET integrated database retrieval system