KEGG   Limnohabitans sp. 103DPR2: L103DPR2_00356Help
Entry
L103DPR2_00356    CDS       T04120                                 

Gene name
tufA_1
Definition
(GenBank) Elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
lim  Limnohabitans sp. 103DPR2
Brite
Translation factors [BR:lim03012]
 Eukaryotic Type
  Elongation factors
   L103DPR2_00356 (tufA_1)
 Prokaryotic Type
   L103DPR2_00356 (tufA_1)
Mitochondrial biogenesis [BR:lim03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    L103DPR2_00356 (tufA_1)
Exosome [BR:lim04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   L103DPR2_00356 (tufA_1)
  Exosomal proteins of breast cancer cells
   L103DPR2_00356 (tufA_1)
  Exosomal proteins of colorectal cancer cells
   L103DPR2_00356 (tufA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
404843..406033
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAAKFGGAAKAYDQIDAAPEEKARG
ITINTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIQGSAKLALE
GDKGPLGEEAIMKLAAALDSYIPTPDRAVDGSFLMPVEDVFSISGRGTVVTGRIERGIIK
VGEEIEIVGIADTQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVQRGQVLCKPGS
IKPHTHFTGEIYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGAIELPEGKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagagaaatttgagcggacaaaaccgcacgtgaacgttggcaccattggtcac
gttgaccacggcaaaacaacattgacagctgcgatcaccaccgtgttggcagccaagttc
ggcggcgctgctaaagcgtacgaccaaattgatgcagcccctgaagagaaggctcgcggt
attacgattaacacagcgcacgttgagtacgagacagaaaaccgtcactacgcacacgtt
gactgcccaggccacgctgactatgtgaagaacatgattacaggtgctgctcagatggac
ggcgctattttggtctgctctgctgctgacggccccatgccccagacacgtgagcacatc
ctgcttgctcgccaagtgggcgtgccttacatcatcgttttcttgaacaagtgcgacatg
gtggacgacgccgagttgctcgagttggtggaaatggaagttcgcgagttgttgtccaag
tacgacttcccaggcgacgacacaccgatcattcaaggctcagccaagctggctttggaa
ggcgacaagggtcctttgggcgaagaagccatcatgaagttggcagccgctttggactct
tacatccctacgcctgaccgcgcagtggacggctctttcttgatgccagtggaagacgtg
ttctccatctctggtcgcggcactgtggtgacaggccgtatcgagcgcggcatcatcaag
gttggtgaagagatcgagatcgttggtattgctgacacgcaaaaaaccacttgtacaggc
gttgagatgttccgcaagttgctggaccaaggtcaagcgggtgacaacgtgggtattttg
ctccgcggtacaaagcgcgaagacgtgcagcgcggccaagtgctgtgcaagcccggttct
atcaagccccacacacacttcacaggcgagatctatgtcttgtctaaagacgaaggtggc
cgtcacacgcccttcttcaacaactaccgtcctcagttctacttccgtacgactgacgtg
acaggcgcgatcgaattgccagaaggcaaagagatggtgatgcctggtgacaacgtgtcg
atcactgtgaagttgatcaacccgatcgccatggaagaaggtctgcgttttgcgatccgc
gaaggcggccgcactgtgggcgctggcgttgttgccaaaatcatcgcttaa

DBGET integrated database retrieval system