KEGG   Limnohabitans sp. 103DPR2: L103DPR2_00452Help
Entry
L103DPR2_00452    CDS       T04120                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
lim  Limnohabitans sp. 103DPR2
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lim00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    L103DPR2_00452
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    L103DPR2_00452
   00982 Drug metabolism - cytochrome P450
    L103DPR2_00452
   00983 Drug metabolism - other enzymes
    L103DPR2_00452
 Human Diseases
  Cancers
   05200 Pathways in cancer
    L103DPR2_00452
   05204 Chemical carcinogenesis
    L103DPR2_00452
   05225 Hepatocellular carcinoma
    L103DPR2_00452
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    L103DPR2_00452
  Drug resistance
   01524 Platinum drug resistance
    L103DPR2_00452
Enzymes [BR:lim01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     L103DPR2_00452
Transporters [BR:lim02000]
 Other Transporters
  Pores ion channels [TC:1]
   L103DPR2_00452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(483311..483961)
Genome map
AA seq 216 aa AA seqDB search
MLKLCGFGASNYHNKVKLALLEKGVAFEEELVWVGETDPLGSPLGKVPYLKTEHGNLCES
TVMVEYIEQAYPAHPLMPQDPFAAAKVRELMTFLDLHLELLARNLYPEAFFGGKVSDATK
EKIGAQLEKNVAAFATLAQFKPFIAGAEMTLADCTAAVHLPVITAATKTIYGRDFLADLP
VKAYMKMWAERPSMQRVHADRKASNELFMARMTSKP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaactctgcggctttggcgccagcaactatcacaacaaagttaaattggcgctg
cttgaaaagggcgtggcctttgaagaagagttggtttgggtgggcgaaacagacccattg
ggcagtccgttgggcaaagtgccttatttgaaaacagaacacggcaacctgtgcgaatcg
actgtgatggtggaatacatcgagcaagcctatcccgcccaccccttgatgccccaagac
ccctttgctgctgccaaagtgcgcgagttgatgacgttcttggacttgcacttggaattg
cttgcgcgcaatttgtatccagaggctttctttggcggcaaggtcagcgatgccaccaaa
gaaaaaattggtgcgcagcttgagaaaaacgtggcggcctttgccaccttggcgcagttc
aagcctttcattgccggcgcagaaatgaccttggccgactgcaccgctgctgttcacttg
ccagtgatcacggccgccaccaaaaccatctatggccgtgacttcttggcggacttgccc
gtcaaagcctacatgaagatgtgggcagaaagacccagcatgcaacgcgtgcatgctgat
cgcaaagcaagcaacgagctcttcatggcgcgcatgacaagcaagccctga

DBGET integrated database retrieval system