KEGG   Listeria innocua: lin2528Help
Entry
lin2528           CDS       T00067                                 

Definition
(GenBank) highly similar to glutamate decarboxylases
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
lin  Listeria innocua
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:lin00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    lin2528
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lin2528
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    lin2528
   00430 Taurine and hypotaurine metabolism
    lin2528
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    lin2528
Enzymes [BR:lin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     lin2528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
LinkDB All DBs
Position
complement(2549470..2550873)
Genome map
AA seq 467 aa AA seqDB search
MLYSENDKRKHESYRIPLFGSEEESTSIPKYVLKKEPMEPRIAYQLVKDQLMDEGNARQN
LATFCQTYMEKEAEILMAETLEKNAIDKSEYPQTAELENRCVNILADLWNAPKEMSYLGT
STVGSSEACMLGGLAMKFRWRNNAEKRGLDIQAKRPNLIISSGYQVCWEKFCVYWDVDMR
VVPMDKEHLSLDVEKVFELVDEYTIGIVGILGITYTGKFDDIALLDEKVEAYNEANEHQL
VIHIDGASGAMFTPFVNPELPWDFRLKNVVSINTSGHKYGLVYPGVGWILWKDKEYLPKE
LIFEVSYLGGSMPTMAINFSRSASQIIGQYYNFLRYGFEGYREIHEKTKKTALYLSKTVE
KSGYFEIINDGSNLPIVCYKLKDDLDVEWTLYDLADQLLMKGWQVPAYPLPADLSDTIIQ
RFVCRADLGYNVAEEFAADFADALHNLEHARVLYHDKERNDSYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctttatagtgaaaacgacaagcgaaaacatgaaagttatcgaatcccgctctttgga
tctgaagaagaaagtactagcatcccgaaatacgtattaaaaaaggaaccaatggaaccg
cgcattgcttatcaattagtgaaagatcagctgatggatgaaggaaatgcgagacagaac
ttggcgactttttgtcagacatatatggaaaaagaagccgaaatattgatggcagaaaca
ctggaaaaaaatgctatcgacaaatctgagtatccacaaacagcagaactagaaaatcgc
tgcgttaatattttagcggatttatggaatgcgccaaaagaaatgtcttatctaggcact
tccactgttggttcttcggaagcgtgtatgcttggcggcttggcaatgaaatttcgttgg
cgtaataatgctgaaaaacgtggtctagatattcaagcgaaacggccaaatttaattatt
tcatcaggctaccaagtgtgttgggaaaaattttgtgtgtactgggatgttgatatgcgt
gtcgttccaatggataaagagcatctaagtcttgatgttgagaaggtatttgagttagtg
gatgagtatacgattggtatcgttgggattttaggtattacttacacaggaaaattcgat
gatattgctttattagatgaaaaagtagaagcttataatgaagcaaacgagcatcaatta
gtgattcatattgacggggcaagtggcgcaatgtttactccatttgtaaatccagaatta
ccgtgggattttaggcttaaaaatgtggtttcaatcaatacttctggtcataaatatggc
ttagtttatccgggtgttggttggattttatggaaagataaagaatatttaccaaaagag
cttatttttgaagtgagttatttaggtggttcaatgccaaccatggcgattaatttttcg
cgtagtgctagtcaaattattggtcaatattataatttcttgcgttatggttttgaaggc
taccgagaaattcacgaaaaaacaaagaaaacagcactatatctctcaaaaacggtagaa
aaaagtggctactttgaaattattaatgatggctctaatttgccgattgtctgttataag
ttgaaagatgaccttgatgttgagtggacgctctatgatcttgcggaccagcttcttatg
aaaggctggcaagttccggcttatccgctgccggctgatttaagtgatacgattattcag
cggtttgtttgccgggcggacttaggttataatgtggcagaagaatttgcagctgatttc
gcggatgcactccacaatttagaacatgctagagtgctttatcatgataaggaacgaaac
gattcttacggatttacgcattaa

DBGET integrated database retrieval system