KEGG   Lawsonia intracellularis N343: LAW_00269Help
Entry
LAW_00269         CDS       T02437                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
lir  Lawsonia intracellularis N343
Pathway
Alanine, aspartate and glutamate metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:lir00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LAW_00269
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LAW_00269
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LAW_00269
   00430 Taurine and hypotaurine metabolism
    LAW_00269
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    LAW_00269
Enzymes [BR:lir01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LAW_00269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(324070..325578)
Genome map
AA seq 502 aa AA seqDB search
MATARKAVVKKMPVGHGTKRGSMGNRTQKSSMSNGVVRHELLDDVFAEDDLSQTLPKYQM
PLYEHRPRDIYQAVHDELMLDGNARQNLATFCQTWVDPEIHKLMDECVAKNMIDKDEYPQ
TAELEMRCVNMLADLWNSPDPTNTIGCSAIGSSEAAMLGGMALKWRWRAQRKKAGKSTDK
PNLVCGPVQICWHKFARYWDIELREIPMEKNRLIMSPEEAIKRCDENTIGVVPTLGVTYT
GQYEPVEEVSNALDALQKKKGWDIPIHVDAASGGFLAPFIEPELVWDFRLPRVKSINSSG
HKFGLAPLGMGWVVWREKTDLPEDLIFWVNYLGSNIPTFAINFSRPGGQIVCQYYNLLRL
GREGYRRIHQACYDTTDYLANELTKTGIFKILYGGKTGIPALTWTLKDEKKYPFSLYDLS
DRLRTRGWQVPAYSMPANRTDLVVMRVLVRHGFDHDLADLLVNDIHRAIEHLKQNPRRKP
LGSGQVTSYDHSGRSSIPQKKK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgcaagaaaggctgtagtaaaaaaaatgcctgtggggcatggaacaaaaaga
ggatctatggggaataggacacaaaaatcatccatgagtaatggtgtggtacgtcatgaa
ttattagatgatgtttttgcagaagatgatcttagtcaaaccttacctaagtatcaaatg
ccactgtatgagcatagacctagagatatttatcaggctgttcatgatgagcttatgcta
gatggtaatgcacggcaaaatcttgcaacattttgtcagacttgggttgatcctgaaatc
cataaacttatggatgaatgtgttgctaagaacatgattgataaggatgaatatccacag
acagcagaactggaaatgcgctgtgtaaatatgttagctgatctttggaattccccagat
ccaacaaatacaataggatgttcagctattggttctagtgaagcagccatgcttggtggt
atggcattaaagtggagatggagggcacaaagaaaaaaagctggaaaatcaacagataag
cctaacttagtatgtggacctgtacaaatctgttggcataaatttgctcgctattgggat
attgagttacgtgaaattcccatggaaaaaaatagacttattatgtcaccagaagaagcc
atcaaacgctgtgatgaaaatacaataggcgtggtccctacattaggtgtaacatataca
ggtcagtatgaacctgtagaagaggttagtaatgcattagatgcattacaaaagaagaaa
ggatgggatattcccattcatgttgatgcagcaagtggaggatttcttgcaccatttatt
gagcctgagctagtatgggattttcgcttacctcgtgtaaaatctattaactcttcagga
cataagtttggacttgcacctttaggtatgggctgggttgtatggagagagaaaactgat
ttacctgaagatcttattttttgggtaaactatttaggaagtaatattcctacatttgct
attaatttttctagacctggaggacaaatagtttgtcaatattataacttacttcgctta
ggtcgtgagggatatcgtcgtattcatcaggcttgttatgatacaacagattaccttgcc
aatgagttgacaaagactggaatttttaaaattttgtatggtggtaaaacaggtatacca
gctttaacatggacacttaaagatgaaaaaaagtacccatttagtttatatgatctttca
gatcgtttaagaactcgtggatggcaagttccagcatattcaatgcctgctaatcggact
gatcttgttgtaatgagagtccttgttcgtcatggttttgatcatgatttagccgatctt
ttagtaaatgatatacatcgtgctattgaacaccttaaacaaaatccaagacgtaagcca
ttgggttcaggtcaagttacaagttatgatcactctggacgttcatctattcctcaaaaa
aagaaataa

DBGET integrated database retrieval system