KEGG   Listeria ivanovii WSLC3009: AX25_07485Help
Entry
AX25_07485        CDS       T03045                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
liw  Listeria ivanovii WSLC3009
Brite
Enzymes [BR:liw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AX25_07485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AHI55939
LinkDB All DBs
Position
complement(1510020..1510628)
Genome map
AA seq 202 aa AA seqDB search
MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVSGHAELASKPVEELVAN
LDSVPEEIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGNLKAAIESEFGTFDEFKEKFN
AAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSEGKTPVLGLDVWEHAYYLKFQNRRPE
YIDTFWNVINWDEANKRFDAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgaattaccaaaattaccttatacttatgatgctttggagccgaattttgat
aaagaaacaatggaaattcactatacaaagcaccacaatacttatgtaacaaaactaaat
gaagcagtctcaggacacgcagaacttgcaagtaaacctgtggaagaattagttgctaat
ctagatagcgttcctgaagaaattcgtggcgcagtacgtaaccacggtggtggacatgct
aaccatactttattctggtctattcttagcccaaatggtggtggtgctccaactggtaac
ttaaaagcagcaatcgaaagcgaattcggcacatttgatgaattcaaagaaaaattcaat
gcggcagctgcggctcgttttggttcaggatgggcatggctagtagtgaacaatggtaaa
ctagaaattgtttccactgctaaccaagattctccacttagcgaaggtaaaactccagtt
cttggcttagatgtttgggaacatgcttattatcttaaattccaaaaccgtcgtcctgaa
tacattgacacattttggaatgtaattaactgggatgaagcaaataaacgctttgacgca
gcaaaataa

DBGET integrated database retrieval system