KEGG   Lotus japonicus: Lj2g3v0179290.1Help
Entry
Lj2g3v0179290.1   CDS       T04348                                 

Gene name
Lj2g3v0179290.1
Definition
(Kazusa) -
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
lja  Lotus japonicus
Pathway
lja00630  Glyoxylate and dicarboxylate metabolism
lja00710  Carbon fixation in photosynthetic organisms
lja01100  Metabolic pathways
lja01200  Carbon metabolism
Module
lja_M00165  Reductive pentose phosphate cycle (Calvin cycle)
lja_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
lja_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:lja00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Lj2g3v0179290.1 (Lj2g3v0179290.1)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Lj2g3v0179290.1 (Lj2g3v0179290.1)
Enzymes [BR:lja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Lj2g3v0179290.1 (Lj2g3v0179290.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
LinkDB All DBs
AA seq 177 aa AA seqDB search
MASSMISSPAVTTVNHANMVAPFTGLKSMAGFPVTRKANNDITSIASNGGRVNCMQVWPP
IGKKKFETLSYLPPLTVEQLAKEVEYLIRKGWVPCLEFETEKGFVYRENHKSPGYYDGRY
WTMWKLPMFGTTDASQVLKELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAHRPEGY
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctctatgatttcctcccctgctgttaccactgttaaccatgccaacatggtt
gccccattcactggtctcaaatccatggctggtttcccagttacaagaaaggccaacaat
gacatcacctccattgcaagcaatggtggaagagtcaactgcatgcaggtgtggcctcca
attggcaagaagaagtttgagaccctttcttaccttccaccactcaccgtggagcaattg
gcaaaggaagtagaataccttatcaggaagggatgggttccttgcttggaatttgagact
gagaaagggtttgtgtaccgtgagaaccacaagtcaccaggatactatgatggacgttac
tggacaatgtggaagctgcccatgtttggaaccactgatgcttctcaggttttgaaggaa
cttgaggaggccaagaaggcataccccaacgccttcatccgtatcatcggattcgacaac
aagcgccaagtgcagtgcatcagtttcatcgcacacaggccagaaggctactaa

DBGET integrated database retrieval system