KEGG   Lotus japonicus: Lj4g3v1440870.1Help
Entry
Lj4g3v1440870.1   CDS       T04348                                 

Gene name
Lj4g3v1440870.1
Definition
(Kazusa) -
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
lja  Lotus japonicus
Brite
Enzymes [BR:lja01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Lj4g3v1440870.1 (Lj4g3v1440870.1)
Chromosome [BR:lja03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     Lj4g3v1440870.1 (Lj4g3v1440870.1)
   HDAC complexes
    Sin3A-HDAC complex
     Lj4g3v1440870.1 (Lj4g3v1440870.1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Lj4g3v1440870.1 (Lj4g3v1440870.1)
  Chromatin remodeling factors
   NuRD complex
    Lj4g3v1440870.1 (Lj4g3v1440870.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
LinkDB All DBs
AA seq 468 aa AA seqDB search
MVMEEERKIEEGASLPSGPDAKKKRVTYFYEPSIGDYYYGQGHPMKPHRMRMAHNLIVHY
SLHRRMEINRPFPAGPDDIRRFHSDDYVEFLASVTPETLSEPIFARQLKRFNVGEDCPIF
DGLFNYCQASAGGSLGAAVKLNRGEADIAINWAGGMHHAKKCEASGFCYVNDIVLGILEL
LKVHRRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKFGDFFPGTGHIKDIGVGSGKHYA
LNVPLNDGMDDENFRVLFQAVIQKVMEVYQPEAVVLQCGADSLSGDRLGCFNLSVKGHAD
CLRFVKSFNVPLMIVGGGGYTIRNVARCWCYETAVAVGVEPDNKLPYNEYYEYFGPDYTL
HVDPSNMENLNTPKDLERIRNTLLEQISRLPHAPSAPFQTTPSTTEVPEEEEEGMDRRPQ
CRKWNGEEYDSDFDEDEKDDLKHSKLTDHMRDVSNDMEEEKPVVHPPS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggttatggaggaggagagaaagatagaggaaggtgcttcccttccatcgggaccagac
gcgaagaagaagagagtcacctacttctacgaaccatcgatcggcgattactactacggc
caaggccacccgatgaaaccccaccggatgcgtatggcccacaatctcatcgtccattac
tccctccaccgccgcatggagatcaatcgccccttccccgccggccctgacgacatccgc
cgcttccactccgacgactacgtcgagtttcttgcctctgtcacccctgagactctctcg
gagccaatcttcgcccgccagcttaagcgcttcaacgttggtgaggattgtcctattttt
gatggtcttttcaattactgccaggcctccgccggtggctccctcggcgccgccgtcaag
ctcaaccgcggtgaggctgacattgctatcaattgggctgggggcatgcatcatgctaag
aagtgtgaagcttctggcttctgttatgtcaatgacattgtgcttggtatcctcgagctt
ctcaaagttcataggcgtgtgctgtacattgacatagatgttcaccatggtgatggtgtg
gaagaggccttctacacaactgatagagtgatgacagtatctttccataagtttggggac
tttttccccggcactggacacatcaaggacattggagtgggctcaggaaagcattatgct
ctcaatgtcccattaaatgatggaatggatgatgaaaatttccgtgttctgtttcaagct
gtcattcaaaaagtcatggaggtttatcagcccgaagcggttgttcttcaatgtggagct
gattccttgtctggtgataggttgggttgcttcaacttgtctgtgaaaggtcatgcagat
tgccttcgtttcgttaaatctttcaatgttcctctaatgattgttggtggcggaggatat
acgattcggaatgtggctcgttgttggtgttatgagactgcagtagcagtaggagtggag
cctgataacaagctgccttacaatgaatactatgagtattttggcccagattatactctc
catgttgatccaagcaacatggagaacctaaacacacccaaggatttggaaagaataagg
aacactttactagaacagatttcccgacttccccatgctcccagtgcaccttttcagaca
acaccatcaaccacagaagtgccagaagaggaggaagagggcatggatagaagaccacag
tgtcgcaagtggaatggtgaagagtatgattctgattttgatgaagatgaaaaggatgac
ctcaagcactcaaaattaactgaccatatgagggatgtttcaaatgacatggaagaagag
aagccagtagtgcatccaccatcttgatgt

DBGET integrated database retrieval system