KEGG   Lotus japonicus: Lj6g3v0339500.1Help
Entry
Lj6g3v0339500.1   CDS       T04348                                 

Gene name
Lj6g3v0339500.1
Definition
(Kazusa) -
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lja  Lotus japonicus
Pathway
lja00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lja00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Lj6g3v0339500.1 (Lj6g3v0339500.1)
Enzymes [BR:lja01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Lj6g3v0339500.1 (Lj6g3v0339500.1)
Transporters [BR:lja02000]
 Other Transporters
  Pores ion channels [TC:1]
   Lj6g3v0339500.1 (Lj6g3v0339500.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_2 GST_N_3 GST_C GST_N_2 GST_C_6 GST_C_5 GST_C_3
Motif
LinkDB All DBs
AA seq 220 aa AA seqDB search
MAENKVVLLDFWPSSYGMRVKIALAEKGISYECKQEDFQAKSSLLLEMNPVHKMIPVLIH
NGKPICESLNIVEYIDEAWNHKPSLLPADPYKRSQARFWGDYIDKNVYSIGKRVWTGKGE
DQEEGKKKFIECLKILEGELGDKPYFGGDNFGYVDVALVPFTSWFYTYETCGKLSIEEEC
PKLVAWVKRCIEKESVRKALPHPHKIYEFALQYKQRNGLE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaacaaggtggttctgttggatttctggccaagttcttatggaatgagggtg
aaaatcgctttggcagagaagggcatctcatacgagtgcaagcaagaagattttcaagct
aaaagctctctgcttttagagatgaacccagttcacaaaatgatccctgttttgattcat
aatggaaaacccatatgtgaatcactcaacatcgttgagtacattgatgaagcttggaac
cacaaaccttcccttctaccagctgacccttacaagcgatctcaagccaggttttgggga
gattacattgataaaaatgtatacagcattggaaagagagtgtggacaggaaaaggtgaa
gatcaagaagagggcaagaagaaatttattgaatgcttgaagattttggaaggagagctt
ggagacaagccatattttggtggtgataactttgggtatgtggatgtggctcttgttccg
ttcaccagctggttttacacgtacgagacatgtgggaaactgagcatagaggaagagtgt
cccaagcttgtggcttgggtcaagaggtgcattgaaaaagagagtgtgaggaaggcactc
cctcaccctcacaagatctatgagtttgccctgcaatataaacagagaaatggacttgag
taaaga

DBGET integrated database retrieval system