KEGG   Lotus japonicus: Lj6g3v0393220.1Help
Entry
Lj6g3v0393220.1   CDS       T04348                                 

Gene name
Lj6g3v0393220.1
Definition
(Kazusa) -
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
lja  Lotus japonicus
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lja00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Lj6g3v0393220.1 (Lj6g3v0393220.1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Lj6g3v0393220.1 (Lj6g3v0393220.1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Lj6g3v0393220.1 (Lj6g3v0393220.1)
   00430 Taurine and hypotaurine metabolism
    Lj6g3v0393220.1 (Lj6g3v0393220.1)
Enzymes [BR:lja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Lj6g3v0393220.1 (Lj6g3v0393220.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
LinkDB All DBs
AA seq 507 aa AA seqDB search
MVLSNTASSGSESDLSIHSTFASRYVRTSLPRFKMPQESIPKEAAYQIINDELMLDGNPR
LNLASFVTTWMEPECDKLIMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSDT
AVGVGTVGSSEAIMLAGLAFKRTWQNRRKAEGKPHDKPNIVTGANVQVCWEKFARYFEVE
LKEVKLSEGYYVMDPQKAVDLVDENTICVAAILGSTLNGEFEDVKRLNDLLIEKNKETGW
DTPIHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLP
EELIFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGYEGYKHVMENCRDNMLVLKEG
LQKTGRFEIVSKDNGVPLVAFTLKDHTHYNEFQISDSLRRFGWIVPAYSMPPNTQHVTVV
RVVIREDFSRTLAERLVADIEKVLHELDSLPARVISSTTVTVTGEEDVNKNGKVKKSAIE
TQREITTLWKNFVLERKKLNDKMSVVC
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggttctgtccaataccgcctcttctggctccgagagtgacctttccattcactcaacc
tttgcttcccgctatgtcaggacctcacttcccaggttcaagatgcctcaagagtcaata
ccgaaggaggcagcataccagatcataaatgatgagttgatgctggatggaaacccaaga
ttgaatctagcatcatttgtgaccacttggatggagcctgagtgtgacaagctcatcatg
gcttccattaacaagaactatgttgacatggatgagtaccctgttaccaccgagcttcag
aatcggtgtgtgaacatgatagcacatctttttaatgcaccacttggagactctgatact
gcagttggtgttggcactgttggctcatcagaggccataatgttggctggattggcattc
aaaagaacgtggcagaacagaaggaaagcagagggaaaaccccatgacaagcccaacatt
gtcaccggagccaacgttcaggtttgctgggagaaatttgcaagatactttgaggtggag
ttgaaagaggtgaagctgagtgagggatactatgtaatggaccctcaaaaggctgtggat
ttggtagatgagaacaccatttgtgttgctgctattcttggttccacattaaatggagag
tttgaagatgtcaagcgcttaaatgatcttctaattgaaaagaacaaggaaactggatgg
gacactcctattcatgttgatgcagctagtggcggcttcattgccccgtttatttatcca
gagcttgagtgggactttcgcttaccactagtgaagagcatcaacgttagtggccacaag
tatggtctagtctatgctggaattggttgggttatctggagaaacaaggaggacttgcct
gaggaactcatcttccatatcaactatctcggagctgatcaacccaccttcaccctcaac
ttctccaaaggttctagccaaatcatagctcaatactaccaactaattcgccttggttat
gagggctataaacatgtgatggaaaactgcagagacaacatgttagtactaaaagagggg
cttcaaaaaactggtcgctttgaaattgtgtccaaagacaatggtgtgcctctggtggcc
ttcacactgaaggaccacacacactataatgaattccaaatctcagactcgctgaggcgc
ttcgggtggatagtgccggcatacagcatgcccccaaatactcagcacgtgaccgtggtc
cgtgtagtcattagggaggacttctcaaggaccctagcagagcgtcttgtggctgatatt
gagaaagtgctgcacgagcttgattcactccctgcaagggtgataagtagcaccactgtg
actgttaccggagaagaagatgtgaacaagaatgggaaggttaagaagagtgctattgag
acacagagggaaatcactacactttggaagaattttgtgttggaaaggaagaagctgaat
gacaagatgagtgttgtttgttaagag

DBGET integrated database retrieval system