KEGG   Lactobacillus johnsonii N6.2: T285_01790Help
Entry
T285_01790        CDS       T02941                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ljn  Lactobacillus johnsonii N6.2
Pathway
ljn00010  Glycolysis / Gluconeogenesis
ljn00260  Glycine, serine and threonine metabolism
ljn00680  Methane metabolism
ljn01100  Metabolic pathways
ljn01110  Biosynthesis of secondary metabolites
ljn01120  Microbial metabolism in diverse environments
ljn01130  Biosynthesis of antibiotics
ljn01200  Carbon metabolism
ljn01230  Biosynthesis of amino acids
Module
ljn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T285_01790
  Energy metabolism
   00680 Methane metabolism
    T285_01790
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    T285_01790
Enzymes [BR:ljn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     T285_01790
Membrane trafficking [BR:ljn04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    T285_01790
Exosome [BR:ljn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   T285_01790
  Exosomal proteins of melanoma cells
   T285_01790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AHA96835
UniProt: V5P291
LinkDB All DBs
Position
374354..375043
Genome map
AA seq 229 aa AA seqDB search
MKRKLAKLVLVRHGESVANRDNVYTGWNDVPLSKKGIEQAKNAGLKVEKIAEFAPTHIHT
SVLSRAIMTANIIADVCSFLYLPITKTWCLNERHYGALRGINKDVSKKIFGTNQVLEWRR
GFDSVPPLLTQPVQDRRYQKYDMRLMPQGESLHQTQERLMPYFWDHIAPELMAGHDQLVV
AHGSSLRALIKKIEDISNEDIVKVEVPNAEPIVYTFDTDLHIVKKEILH
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagaaagttggccaaattagttttggttagacatggtgaaagtgtagctaatcgt
gacaatgtttatacgggttggaatgatgtacctttaagtaaaaaagggattgagcaggca
aaaaatgcaggccttaaggtagaaaaaatagctgaatttgcaccaacgcatatccatact
tctgtcttatcgcgtgcaattatgacggctaatattattgcagatgtgtgcagcttttta
tatttaccgatcactaagacttggtgtttaaacgagcgtcactatggagcacttcgcggt
attaataaggatgtttcaaagaaaatttttggtactaatcaagtcttagaatggagacgt
ggttttgatagtgtgcctcctttattaacgcagcccgtccaagatcgtagatatcaaaag
tatgatatgcgtttaatgcctcagggagaaagtttacatcaaactcaagaaagactaatg
ccttatttttgggatcatattgcacctgaattaatggcaggtcatgatcaattggttgta
gcccatggctcaagtttacgtgccttgattaaaaaaattgaagatatcagtaatgaggat
attgtaaaagtagaagtgcccaatgcggagccaattgtttatacttttgatactgatttg
catattgtaaagaaagaaattctacattga

DBGET integrated database retrieval system