KEGG   Leuconostoc kimchii: LKI_07680Help
Entry
LKI_07680         CDS       T01233                                 

Definition
(GenBank) conserved Archaeal protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lki  Leuconostoc kimchii
Pathway
lki00620  Pyruvate metabolism
lki00680  Methane metabolism
lki01100  Metabolic pathways
lki01120  Microbial metabolism in diverse environments
lki01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LKI_07680
  Energy metabolism
   00680 Methane metabolism
    LKI_07680
Enzymes [BR:lki01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LKI_07680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase
Motif
Other DBs
NCBI-ProteinID: ADG41075
UniProt: D5T4D7
LinkDB All DBs
Position
complement(1501180..1502697)
Genome map
AA seq 505 aa AA seqDB search
MTQRKIPTIMGTQHPDNANAPFWDASQQPFISAYREMNEAFENFSELNVDEYMWDWEGKH
ADAAVIDRLFSTEYDYFKKDQIGRDKFLTFRFPNIWEEKGYNLMQAMTAILSSEDFAHDL
GFDQRPLFETILPMAQRADQLIEMQVLFEKLANFKSVEFTKNDRNTPYIEMIPLFEDFNT
QLHAPEILKEYLKLHEEHFGFRPKYLRVFLAGSDSALTAGFMSSITGNKLAIARLHEFAQ
EENIDIYPISGTGSAIFRGGLSPRRIDRYLTEFPGVRTATVQSAFRYDFPLEEVQQAIAE
LKEKLPVATPLKISRDDQKILAEVAEESAEFYAHTLDQLVPDMQPIFKAFPKRRDRRQHV
GVLGYSRSVDGIELPRAINFTGSFYSIGVPPEFIGFGRALAHLNADHLSVFVRNYPSMKQ
DFRELAAYVNLDALQILKTQSPAWADVEEDIMTLKNIFDLEIGPKTREQQQHAAIALQVV
QIKEGAPIATTALINRMAQLRHFLG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacgaaaaatccctactattatgggtacacaacaccccgacaacgccaacgca
ccattttgggatgcctcacaacaaccattcattagtgcttatcgtgaaatgaacgaagca
tttgaaaatttcagcgaattaaacgtcgatgaatacatgtgggactgggaaggtaaacat
gccgatgccgctgttattgatcgcctatttagcacagaatatgattattttaaaaaagac
caaattggtcgtgataagtttttgacttttcgttttccaaatatatgggaagaaaagggc
tacaacttgatgcaggccatgacggccattttaagttctgaagactttgcacatgattta
ggatttgaccaacgacctttatttgaaacgatactccccatggcacaacgtgcggatcaa
ctcattgaaatgcaagtgctctttgagaagttggctaattttaaatcagtcgaatttaca
aagaatgatcgcaatacaccttatattgaaatgattcctctatttgaggactttaataca
caattacatgcaccggaaattttgaaagaatatttaaagttacatgaagaacattttggt
ttccgtccaaaataccttcgtgtgttcttggctggatcagactccgcattaacagctggc
ttcatgagttcaattacaggtaataaacttgccatagcaagactacacgaatttgcacaa
gaagaaaatattgatatttatcccatttcaggtacgggctctgctatcttccgtggtggc
ttatcaccacgtcgtattgatcgctatttaacagaatttcctggtgtacgcacggctact
gtacaatcggcttttcggtatgacttccccttggaagaagttcaacaagctattgctgaa
ctaaaagaaaagctccctgtggcaacaccactaaaaatttcacgtgatgatcaaaaaatt
cttgccgaagttgccgaagagtccgctgaattttatgcgcatacacttgatcaacttgtc
cctgacatgcaacctattttcaaagctttcccaaagcgtcgtgatcgtcgtcaacacgtt
ggtgtactcggttattcacgttccgttgacggtattgaattaccacgagcaattaatttt
acaggatcattctattccatcggtgtcccaccagaatttattgggtttggtcgtgcttta
gctcatttgaacgcagatcatctatctgtctttgttcgtaactatcctagtatgaaacaa
gattttcgtgaacttgcagcctatgttaatttagatgctttacaaattttgaaaactcaa
agtcctgcttgggcagatgttgaagaagatattatgactttgaaaaatatctttgacctt
gaaattggtcctaaaacacgtgagcaacaacagcacgctgcaattgctctacaggtcgta
caaattaaggaaggcgcaccaatcgctacgacagcactcatcaaccgtatggcgcaactc
cgccacttcttaggttaa

DBGET integrated database retrieval system