KEGG   Leuconostoc kimchii: LKI_07680Help
Entry
LKI_07680         CDS       T01233                                 

Definition
(GenBank) conserved Archaeal protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lki  Leuconostoc kimchii
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LKI_07680
  Energy metabolism
   00680 Methane metabolism
    LKI_07680
Enzymes [BR:lki01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LKI_07680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1501180..1502697)
Genome map
AA seq 505 aa AA seqDB search
MTQRKIPTIMGTQHPDNANAPFWDASQQPFISAYREMNEAFENFSELNVDEYMWDWEGKH
ADAAVIDRLFSTEYDYFKKDQIGRDKFLTFRFPNIWEEKGYNLMQAMTAILSSEDFAHDL
GFDQRPLFETILPMAQRADQLIEMQVLFEKLANFKSVEFTKNDRNTPYIEMIPLFEDFNT
QLHAPEILKEYLKLHEEHFGFRPKYLRVFLAGSDSALTAGFMSSITGNKLAIARLHEFAQ
EENIDIYPISGTGSAIFRGGLSPRRIDRYLTEFPGVRTATVQSAFRYDFPLEEVQQAIAE
LKEKLPVATPLKISRDDQKILAEVAEESAEFYAHTLDQLVPDMQPIFKAFPKRRDRRQHV
GVLGYSRSVDGIELPRAINFTGSFYSIGVPPEFIGFGRALAHLNADHLSVFVRNYPSMKQ
DFRELAAYVNLDALQILKTQSPAWADVEEDIMTLKNIFDLEIGPKTREQQQHAAIALQVV
QIKEGAPIATTALINRMAQLRHFLG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacgaaaaatccctactattatgggtacacaacaccccgacaacgccaacgca
ccattttgggatgcctcacaacaaccattcattagtgcttatcgtgaaatgaacgaagca
tttgaaaatttcagcgaattaaacgtcgatgaatacatgtgggactgggaaggtaaacat
gccgatgccgctgttattgatcgcctatttagcacagaatatgattattttaaaaaagac
caaattggtcgtgataagtttttgacttttcgttttccaaatatatgggaagaaaagggc
tacaacttgatgcaggccatgacggccattttaagttctgaagactttgcacatgattta
ggatttgaccaacgacctttatttgaaacgatactccccatggcacaacgtgcggatcaa
ctcattgaaatgcaagtgctctttgagaagttggctaattttaaatcagtcgaatttaca
aagaatgatcgcaatacaccttatattgaaatgattcctctatttgaggactttaataca
caattacatgcaccggaaattttgaaagaatatttaaagttacatgaagaacattttggt
ttccgtccaaaataccttcgtgtgttcttggctggatcagactccgcattaacagctggc
ttcatgagttcaattacaggtaataaacttgccatagcaagactacacgaatttgcacaa
gaagaaaatattgatatttatcccatttcaggtacgggctctgctatcttccgtggtggc
ttatcaccacgtcgtattgatcgctatttaacagaatttcctggtgtacgcacggctact
gtacaatcggcttttcggtatgacttccccttggaagaagttcaacaagctattgctgaa
ctaaaagaaaagctccctgtggcaacaccactaaaaatttcacgtgatgatcaaaaaatt
cttgccgaagttgccgaagagtccgctgaattttatgcgcatacacttgatcaacttgtc
cctgacatgcaacctattttcaaagctttcccaaagcgtcgtgatcgtcgtcaacacgtt
ggtgtactcggttattcacgttccgttgacggtattgaattaccacgagcaattaatttt
acaggatcattctattccatcggtgtcccaccagaatttattgggtttggtcgtgcttta
gctcatttgaacgcagatcatctatctgtctttgttcgtaactatcctagtatgaaacaa
gattttcgtgaacttgcagcctatgttaatttagatgctttacaaattttgaaaactcaa
agtcctgcttgggcagatgttgaagaagatattatgactttgaaaaatatctttgacctt
gaaattggtcctaaaacacgtgagcaacaacagcacgctgcaattgctctacaggtcgta
caaattaaggaaggcgcaccaatcgctacgacagcactcatcaaccgtatggcgcaactc
cgccacttcttaggttaa

DBGET integrated database retrieval system