KEGG   Lactobacillus koreensis: ABN16_01945Help
Entry
ABN16_01945       CDS       T03995                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lko  Lactobacillus koreensis
Pathway
lko00010  Glycolysis / Gluconeogenesis
lko00260  Glycine, serine and threonine metabolism
lko00680  Methane metabolism
lko01100  Metabolic pathways
lko01110  Biosynthesis of secondary metabolites
lko01120  Microbial metabolism in diverse environments
lko01130  Biosynthesis of antibiotics
lko01200  Carbon metabolism
lko01230  Biosynthesis of amino acids
Module
lko_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABN16_01945
  Energy metabolism
   00680 Methane metabolism
    ABN16_01945
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABN16_01945
Enzymes [BR:lko01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ABN16_01945
Membrane trafficking [BR:lko04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ABN16_01945
Exosome [BR:lko04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ABN16_01945
  Exosomal proteins of melanoma cells
   ABN16_01945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AKP63881
LinkDB All DBs
Position
complement(398977..399648)
Genome map
AA seq 223 aa AA seqDB search
MATLVILRHGESVANRDNIFTGWSDVPLTAKGRGQAVAAGKLVAETGIQFAALHTSMLQR
AIVTSDIVLEAIDQLYIPEYKSWRLNERHYGALRGKNKAAVQAEVGERQVKIWRRSFETV
PPLLDHVTQDRRYDQFGPHVEPRGESLEMAYHRLMPYWEDQVAPRLLNGDNQLIVAHGST
LRALIKYLDQVADADISQVEVANGEPIQYDFDDRLNVLKKTVL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgctggtcattttacggcacggagagagtgtcgccaaccgggacaatattttt
acagggtggagtgatgttcccctgacggcaaaggggcgtggacaggcggtcgccgctgga
aagctggtcgcggagacgggaattcagtttgcagcgctccacacgtcgatgctacaacgg
gctatcgtgacgtccgatattgtcttggaggccatcgatcagttgtacattccggagtac
aagtcttggcggctaaacgaacggcattacggtgcattgcgtgggaagaataaagcagcc
gttcaagcggaagttggcgagcgtcaagtcaaaatttggcggcggagctttgagaccgtg
ccgcccttactggatcacgtgacacaggaccggcgctatgatcaattcggtccgcacgtt
gaaccccgcggggagagtcttgaaatggcctatcaccgcttgatgccctattgggaagac
caggtggcgccgcgcttgctcaatggtgataatcaactgattgttgcccacggcagtacg
ttgcgagcactgatcaagtatcttgaccaagtggcggatgctgacatcagtcaggttgaa
gtggccaacggcgagcccattcagtacgacttcgatgatcggttgaacgtgttaaagaaa
acagttttgtaa

DBGET integrated database retrieval system