KEGG   Leuconostoc lactis: BCR17_05715Help
Entry
BCR17_05715       CDS       T04460                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
llf  Leuconostoc lactis
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:llf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCR17_05715
  Energy metabolism
   00680 Methane metabolism
    BCR17_05715
Enzymes [BR:llf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BCR17_05715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1155288..1156805)
Genome map
AA seq 505 aa AA seqDB search
MTQRKIPTIMGTQHPDNANAPFWDASQQPFISAYREMNEAFENFSELNVDEYMWDWEGKH
ADAAVIDRLFSTEYDYFKDQQIGRDKFLTFRFPNIWEEKGYNLMQAMTAILSSEDFAHDL
GFEQRPLFEAILPMAQRADQLLKMQVLFEKLANFKSVEFTRSDKNTPYIEIIPLFEDFDT
QLHAPEILKDYLKLHEEHFGFRPKYMRVFLAGSDSALTAGFMSSITGNKLAIARLHEFAR
EENIEIYPISGTGSAIFRGGLSPHRIDRYVKEFPGVRTATVQSAFRYDFPIADVQQAIAE
LKEKLPTAEPLKISAADQKILAEVAEESAEFYTHTLDQLVPDMQPIFKAFPKRRDRRQHV
GVLGYSRSVDGIELPRAINFTGAFYSIGVPPEFIGFGRALENLNADHLSAFVRNYPSMKD
DFRELARFVNLDALAILKTQSPAWADVERDIMIVKDIFDLEIGPKTREEQQHAEIALQVV
QIKEGVPIAITALINRMAQLRHFLG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacgaaaaatccctacgattatgggtacgcaacaccccgataatgcgaatgca
cctttctgggatgcatcccaacaaccttttatcagcgcctatcgcgaaatgaacgaagct
tttgaaaatttcagtgaattaaatgttgatgaatacatgtgggattgggaaggtaagcac
gccgatgctgccgtcattgatcgcctatttagcaccgaatatgattactttaaagaccaa
caaattggtcgtgataaattcttgacgttccgcttcccaaacatttgggaagaaaaaggc
tataacttgatgcaggcaatgactgccattttaagttcagaagatttcgcgcatgattta
ggctttgaacaacggccattatttgaagccattttgccaatggcacaacgcgctgatcag
ttgctaaagatgcaagttttgtttgaaaagctagccaactttaagtcagttgagtttacc
cgttcagataaaaacaccccttatattgaaattattcccctatttgaggattttgacacc
caacttcacgcaccagaaattttgaaagactacctcaagttgcatgaagaacattttgga
ttccgaccaaagtatatgcgtgttttcctggctggatctgattcagcgttgacagctggt
ttcatgagctcaattacgggtaacaagttagccattgcgcgcttacatgaatttgcccgt
gaagaaaacattgaaatttatcccatttcagggactggttcagcgattttccgtggtggc
ttgtcaccacaccgtattgatcgttacgtcaaagaattccctggtgttcgtacggcaaca
gttcagtctgctttccgctatgatttcccaattgctgatgtccaacaagcgattgccgaa
ctaaaggaaaagttaccaaccgctgaaccattaaagatttcagctgctgaccaaaagatc
ttagccgaagtcgctgaagaatcagctgaattttatacgcacacactagaccaattggtg
cctgatatgcaaccgattttcaaggccttcccaaagcgtcgtgaccgtcgccaacacgtt
ggtgtcttaggttactcacgttctgttgacggtattgaattaccacgtgccatcaacttc
accggtgccttttattcaatcggtgtgccaccagaattcatcggctttggccgtgccctt
gaaaacttaaatgctgatcatctgtcagcgtttgtccggaattacccaagtatgaaggat
gacttccgtgaactcgcccgctttgtcaatctcgatgcactcgcaatcttgaagacacaa
agtcctgcttgggctgatgttgaacgcgacattatgattgtcaaagatattttcgacctt
gaaattggtcctaaaacccgtgaagaacaacagcatgccgaaatcgctttgcaagttgtg
caaattaaagaaggtgtgccaattgccattacggctttaattaaccgcatggcgcagctc
cgccacttcttaggataa

DBGET integrated database retrieval system