KEGG   Legionella longbeachae: LLO_2965Help
Entry
LLO_2965          CDS       T01183                                 

Definition
(GenBank) putative acetyltransferase
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
LinkDB All DBs
Position
complement(3447077..3449641)
Genome map
AA seq 854 aa AA seqDB search
MIAEISGEQPKRKIQKYAPSINATNIDLGKSKTIIDVLLAYAGKEEKRPHLYLQNEQGEE
QIISYGQLWDEARNIARGLHKKGIKQGDTVAIMLPTGEEFFYAFSGILLVGATPVPIYPP
FRPDRIEEYAEREAKILHNAQARMLITFVKAGALSHILGAFVPSLKEITTIKELRALTGF
LPEIELEPEDPILIQYTSGSTGDPKGVFLTQQNMLANIRAIGKAIPVQPTDVGVSWLPLY
HDMGLMNWLGAMYFGIPMVILSPLTFLTRPEQWLWSIHYHRATLSGAPNFAYELCIKKIN
KEDIEGLDLSSWRFAFNGAEAVNPKTLELFAKKFSSYGFDKESFAPVYGLAEATVGLTFP
PERRKPRIDQIQRDALEKANKALTTSNNKDIIQFVSCGVPISNHQIRVVDEYGKEAAERF
VGMIQFKGPSAMQGYFNNPKETKKIFHEGWWDTNDLGYVADNELFITGRKKDMIIKAGRN
LYPEEIEEIVSQIPRVRKGCIIAFGVNDPILGTEKLIVVAESYELEKENQEAMRAAINEK
MMDALGISPDVVLFVLPKTVPKTSSGKLRRSACKQAYIEGRLIKSKRSTTLQVVKLLLKG
ASRKIYDGIILVGKFIYTLYVAIILFLLVVPGWLCVLFLPKEAATKIIPLGARCIFKLGM
CPVRFENEGNLNSKTHVIFVANHASYTDALLLLAYLPQGSLFTVKKELLKVPIVRTFIKR
LGYLVIDRQDVAKSIENKNQIAQAIAKKSSVIIFPEGTFTYATGLRPFKLGAFTLAVETQ
AALCPVALSGTRSLLRDGSYLLKPGSIKLTIGKPIYPHEKSWDEMIRLRNLVRLEIAKKC
DEPILDLVIAGLET
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagaaatatctggcgaacaaccaaaaagaaaaattcaaaaatacgcaccatca
attaatgccaccaacattgatcttggcaaatcaaaaacaataatcgatgtattattggct
tatgcaggaaaagaagaaaaacgccctcatttatatctgcaaaatgaacaaggtgaagaa
caaattatttcatatgggcagttatgggatgaggctagaaatatcgctcgcggattgcat
aagaagggaataaaacagggcgacacagtggcaattatgctccccacaggagaagagttt
ttttacgctttttcgggaattttattagtaggtgctacgcctgttcctatttatcctcca
tttcggcccgatcgtatcgaagaatatgcagaacgcgaagctaaaattttacataatgct
caagcccgaatgttaattacttttgtaaaagcgggagcactaagccatatattaggtgct
tttgtacccagtttaaaagagatcactaccataaaggagcttagagcattaacaggcttt
ttgcctgagattgagttagaaccagaagaccctattttaattcaatacacatcgggtagc
acaggtgatcccaaaggagtttttttaactcagcaaaatatgcttgccaatatacgcgca
attggtaaggcaatacctgttcaacctaccgatgtgggcgtgagctggttaccactttat
catgatatggggcttatgaattggctcggagcaatgtattttggtatccccatggttatc
ttatctccacttaccttcttaacgaggccggagcaatggctatggtccattcattatcat
cgcgctacattatcaggagccccaaattttgcttatgaattgtgcatcaaaaaaattaat
aaagaagatattgagggattggatttaagttcctggcgatttgcattcaatggtgccgaa
gctgtaaatccaaaaacattagaactttttgcgaaaaaattttcatcttatgggtttgat
aaagaatcatttgctccagtttatggattagcagaagcaactgttgggctcacttttcct
ccagaaagacgaaaaccacgaatagaccaaatccaaagagacgctttagaaaaagctaat
aaagcgctcaccacatcaaataataaagatattattcaattcgtcagttgtggtgtacct
atatcgaatcaccaaattcgagttgttgatgaatatggaaaagaagcagcagaacgattt
gtcggaatgattcaatttaaaggtccttcggcaatgcaaggttatttcaacaatcctaaa
gagacaaaaaaaattttccatgaaggatggtgggatacaaatgatttaggttacgtggcg
gataatgaattattcattactggtagaaaaaaagacatgattatcaaggctggccgtaat
ctttatccggaagaaatagaagaaatagtcagtcaaataccacgtgtacgaaaaggatgt
attattgcatttggagtcaatgatcctattcttggtacagaaaaattaattgtggttgct
gaatcttatgaacttgaaaaagaaaatcaagaggctatgcgggcagcaattaatgaaaaa
atgatggatgcattaggtatttctcccgatgttgttctttttgtgctacctaaaactgtt
cccaaaacatcaagtgggaaactgcgtcgctctgcatgcaagcaagcatatatagaaggc
aggctcataaaaagtaaaagatcgacaaccttgcaagttgtgaaattattattgaaggga
gcttcaaggaaaatttatgatgggattattttagtaggtaaattcatctatacactctat
gttgctattattttatttttgcttgttgtccctggttggctttgtgttttgtttttgcct
aaagaagcggctaccaaaataattccccttggcgcacgttgtattttcaaattaggaatg
tgcccggttcgttttgaaaatgaaggcaacctaaatagtaaaacacatgtcatttttgtc
gccaatcatgcaagctatacggatgccctgttattacttgcttatctaccacaaggttct
ttatttaccgttaaaaaagaattactaaaggtacccatagttcgaacttttattaaacga
ttaggttacttagtcattgatcgccaggatgttgcaaaaagtattgaaaataaaaatcag
attgcgcaggcaattgcaaagaaaagttcagtgattatttttcccgaaggaacctttact
tatgcaacaggattacgtccttttaaattaggtgcttttactcttgctgtggaaacacaa
gcagcattatgtcctgtagcactatcgggtactcgttcattattacgcgatggaagttat
ttactcaagcctggatcaatcaaactaaccatcggaaaacccatttatccacatgaaaaa
agttgggatgaaatgattagacttcgcaatttagttcgactggaaatagcgaaaaaatgt
gatgaacccatccttgatttagttattgccgggcttgaaacttag

DBGET integrated database retrieval system