KEGG   Lactococcus lactis subsp. cremoris A76: llh_7145Help
Entry
llh_7145          CDS       T01965                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
llr00250  Alanine, aspartate and glutamate metabolism
llr00430  Taurine and hypotaurine metabolism
llr00650  Butanoate metabolism
llr01100  Metabolic pathways
llr01110  Biosynthesis of secondary metabolites
llr01120  Microbial metabolism in diverse environments
llr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    llh_7145
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    llh_7145
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    llh_7145
   00430 Taurine and hypotaurine metabolism
    llh_7145
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    llh_7145
Enzymes [BR:llr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     llh_7145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AEU40605
UniProt: G8P476
LinkDB All DBs
Position
complement(1329021..1330115)
Genome map
AA seq 364 aa AA seqDB search
MLYGKENRDEAEFLEPIFGSESEQVDLPKYKLAQQSIEPRVAYQLVQDEILDEGNARLNL
ATFCQTYMEPEAVKLMSQTLEKNAIDKSEYPRTTEIENRCVNMIADLWNASEKEKFMGTS
TIGSSEACMLGGMAMKFSWRKRAEKLGLDINAKKPNLVISSGYQVCWEKFCVYWDIEMRE
VPMDREHMSINLDKVMDYVDEYTIGVVGIMGITYTGRYDDIKALDNLIEEYNKQTDYKVY
IHVDAASGGLYAPFVEPELEWDFRLKNVISINTSGHKYGLVYPGVGWVLWRDKKYLPEEL
IFKVSYLGGELPTMAINFSHSASQLIGQYYNFVRYGFDGYKAIHERTHKVAMYLAEEIEK
NRNV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgttatacggaaaagaaaatcgcgatgaagcagagttcttggaaccaatttttggttca
gaaagtgaacaagtggatttgcctaaatataaattagctcaacaatcaattgaacctcga
gtggcctatcagttagttcaagatgaaatattagatgaaggaaatgctcgtttaaattta
gccacattctgtcaaacttatatggaacctgaagcagtcaaactaatgagtcagaccttg
gaaaaaaatgcgattgataaatcggaatatccaagaacaactgaaattgaaaaccgttgc
gtcaacatgatcgctgacctttggaatgcgagtgaaaaagaaaaatttatggggacttca
acaattggttcttcagaagcttgtatgcttggtggaatggccatgaagttttcttggcgc
aagcgagcagaaaaattaggcctagatattaatgcgaaaaagccaaacttagtcatttcc
tctggttatcaagtttgctgggaaaaattctgtgtttattgggatattgaaatgcgagaa
gtaccaatggatagagaacatatgtcaatcaatttggataaagtgatggattatgttgat
gaatatacgattggggtagttggaattatggggattacttatactggtcgttatgatgat
atcaaagctttggataatttgattgaagaatataataaacagacagactataaagtttat
attcacgtagatgctgcttcaggaggactttatgctccttttgttgagccagaacttgag
tgggatttccgtttgaaaaatgtcatttcaatcaatacttcaggacataaatatggttta
gtatatcctggtgtaggttgggtcttgtggcgtgacaaaaaatatttacctgaagagtta
atttttaaagtaagttatcttggaggagaattaccaacaatggcgattaatttttctcac
agtgcttctcaattaatcggtcaatactataattttgtacgttatggatttgatggatat
aaagctattcatgagagaacgcataaagtagccatgtatttagcagaagaaattgaaaaa
aacaggaatgtttga

DBGET integrated database retrieval system