KEGG   Labilithrix luteola: AKJ09_08423Help
Entry
AKJ09_08423       CDS       T04033                                 

Definition
(GenBank) Non-ribosomal peptide synthase
Organism
llu  Labilithrix luteola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: AKV01760
UniProt: A0A0K1Q8P7
LinkDB All DBs
Position
complement(8818489..8820375)
Genome map
AA seq 628 aa AA seqDB search
MATASSNAEYPAFPTLAHAIEHAAKADPTLGFRFVSEDGVPGFSPSATSEASFSYTALER
SSARYGGALQALGLEKGDRVALILPANEDFVLCFFGAIRAGIIPVPIYPPLGIGQLQTYL
DNTRHIVAKSGARALVTTSQIKRLLGTVQASSPSLEQVVAVEAIRESLEPLKGVKLTPDD
VAFLQFTSGSTSRPKGVTLTHANLMANMRCIVEDGLKMRSHDVGVSWLPLYHDMGLIGFV
IAPLAMRTPVVFLPPLLFLKRPITWFQAMTRHKGTVSFGPNFAFALCVKRIREKELEGID
LSSWRVAGCGAEPIRPETLENFVNAFSKVRFDKNALLPSYGMAESSLAVTFTELGEGMKT
IAVDSDTLWAENVAKKTEPSAERAIRLVSCGKAFPLHDVRVFAEGDETGATPLPEGHVGE
LRIKGPSVMKGYWEDAERTKSTFAGEWLKTGDLGFLDSGHVFICGRSKEVIIVNGRNYYP
QDIEWEASHVAGVRKGNIIAFGARDPSGVERDRERVVVAFEVQDAPKELDARALAAARQP
IVAAIRKAVQEGMGLVLDDVVPLAHGVLPKTSSGKLQRAKTRELYEAGELLSRKGTREHD
RVGMLKEAAKSQLSYFKLAVLGGRKKDD
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgcgtcgtccaacgccgagtaccccgccttccccacgctggcccatgccatc
gaacacgccgcgaaggcggacccaaccctagggttccgcttcgtctccgaagacggcgtg
cctggtttttcgccttccgcgaccagcgaggcgtcgttctcttacacggccctcgagcgg
tcgagcgcccgctacggcggagcgctacaggccctcggcctggagaagggtgaccgcgtc
gccctgatcctgccggccaatgaggacttcgtcctttgcttcttcggggccattcgggcg
ggcatcatccccgtccccatctatccccccctggggattggccaactgcagacctatctc
gacaacacgcgccacatcgtcgccaagagcggcgcccgcgcgctcgtgaccacgtcgcag
atcaagcgcctgctcggcaccgtccaagcctcgtcgccgtcgctcgagcaggtcgtcgcc
gtcgaggcgatccgcgagtcgctcgagccgctcaagggcgtgaagctcacgcccgacgac
gtcgccttcctccagttcacgagcggttcgacctcgcggccgaagggcgtgaccctcacc
cacgccaacctcatggcgaacatgaggtgcatcgtggaggacggcctgaagatgcgcagc
cacgacgtcggcgtctcgtggctgccgctctaccacgacatggggctcatcggcttcgtc
atcgcccctctggcgatgcgaacgcccgtcgtgttcttgccgcccctcctcttcctcaag
cgccccatcacctggttccaggcgatgacgcgccacaagggaacggtctcgttcgggccg
aacttcgccttcgcgctctgcgtgaagcgaatccgagagaaagagctcgaaggcatcgac
ctttcgagctggcgcgtcgccggctgcggtgccgagcccattcgccccgagaccctcgag
aacttcgtcaacgcgttttcgaaggtgcgcttcgacaagaacgcgctcctgccctcttac
ggcatggcggagtcgtcgctcgcggtcaccttcaccgagctcggtgagggcatgaagacc
atcgcggtcgacagcgacacgctttgggccgagaacgtcgcgaagaagaccgagcccagc
gccgagcgcgcgatccgcctcgtgtcctgcggcaaggctttcccgctgcacgacgtccga
gtcttcgctgaaggcgacgagacgggcgcaacgccgctgcccgaaggtcacgtcggcgag
ctccgcatcaagggcccgagcgtgatgaagggctactgggaagacgccgagcgcacgaag
agcaccttcgcgggcgagtggctgaagactggcgacctcggcttcctcgacagcggccac
gtcttcatttgtggccgttcgaaggaagtcatcatcgtcaacgggcgcaactactacccg
caggacatcgagtgggaggcgagccacgtcgccggcgtccgcaagggcaacatcatcgcc
ttcggcgcgcgtgatccgtccggcgtcgagcgcgaccgtgagcgcgtggtcgtcgccttc
gaggtgcaagacgccccgaaggagctcgatgctcgcgccctcgccgcggcccgccagccg
atcgtcgcggccatccgcaaggccgttcaagaagggatgggcctcgtcctcgacgacgtg
gttcctctcgcccatggcgtgctcccgaagacctcgagcggcaagctccagcgtgcgaag
acccgcgagctctacgaagccggcgagcttctcagccgcaagggcacgcgcgagcacgat
cgcgtgggcatgttgaaggaagccgccaagagccagctctcgtacttcaagctcgccgtg
ctcggcggtcgcaagaaggacgactga

DBGET integrated database retrieval system