KEGG   Labilithrix luteola: AKJ09_08936Help
Entry
AKJ09_08936       CDS       T04033                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
llu  Labilithrix luteola
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:llu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AKJ09_08936
   00650 Butanoate metabolism
    AKJ09_08936
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AKJ09_08936
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AKJ09_08936
Enzymes [BR:llu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AKJ09_08936
Amino acid related enzymes [BR:llu01007]
 Aminotransferase (transaminase)
  Class III
   AKJ09_08936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(9398455..9399789)
Genome map
AA seq 444 aa AA seqDB search
MSDGKRTSADIRAKHKEFLFPSVGTFYEEPVCLDSGHGARLEDLDGRKYLDFFGGILTVS
VGQTHPKVNAALHAQIDRLGHVSTLYPTVGIVELAEKLIHLAPGRIGKAGKAFFTASGTE
ADETAVALAQLATGRQELIALRHGYSGRSMLAQSLTAHSKYRAVTSQVPGIKHAHAPYCY
RCPFGATVQHCDFKCAKDIEELIQTTTTGQVAGFLAEPIQGVGGFIVAPDGYFKVAVDIV
RNYGGLFICDEVQTGFGRTGSKMWGIEHHEGVEPDIMTMAKGIANGLPIGACLATVPVAD
SWKGGNISTFGGNPISTAAANATIDVIVEEKLTENAAIMGKYLREGLEALKRKYPKTIGD
VRGKGLMQAIELVKDETQKDRTPDAASTSRLFEETKKRGLLIGRGGLWNNVVRIAPPLNV
TQAEIEEALKSLDESFAAFAEVAR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacggaaagcgcacgagcgcggacattcgcgcgaagcacaaggaatttctcttt
ccgagtgtcggcaccttctacgaagagccggtctgtctcgatagtggccacggtgctcgt
ctcgaggacctcgatgggcgaaagtacctcgatttcttcggcgggattctcacggtgtcc
gtcggacagacgcacccgaaggtcaacgcggcgctccacgcgcagatcgatcgcctcggc
cacgtctcgacgctctacccgacggtggggatcgtcgagctcgccgagaagctgattcac
ctcgcgcccggccgcatcggaaaggcgggcaaggccttcttcacggcgagcggcaccgag
gccgacgagaccgccgtggccctcgcgcaacttgcgaccggccggcaggagctgattgcc
cttcgccacggctactcgggccgctcgatgctcgcgcagtcgctcactgcgcactccaag
taccgcgccgtgacctcgcaggtgccgggcatcaagcacgcgcacgcgccgtattgctac
cgctgccccttcggcgccaccgttcagcactgcgatttcaagtgcgccaaggacatcgag
gagctcattcagacgacgaccacgggtcaggtcgcgggcttcctcgccgagccgatccag
ggcgtcggcggcttcatcgtcgctcccgatggctatttcaaagtcgccgtcgacatcgtc
cggaactacggtggtcttttcatctgcgacgaagtccagacgggcttcggccgaacgggc
agcaagatgtggggcatcgagcatcacgaaggcgtggagcccgacatcatgacgatggcc
aagggcatcgccaacggcctgcccatcggcgcgtgcctcgccacggtgccggtcgccgac
tcctggaagggcggcaacatctccacgttcggcggtaacccgatcagcacggcggctgcg
aacgcgaccatcgacgtcatcgtcgaggagaagctcacagagaacgcggccatcatgggc
aagtacctgcgcgagggcctcgaagccctgaagcgcaagtacccgaagaccatcggcgac
gtccgcggcaagggcctcatgcaggccatcgagctcgtcaaagacgagacgcagaaggac
cgcacgcccgacgccgcctcgacctcgcgtctcttcgaggagaccaagaagcgcgggctt
ctgatcggtcgcggcggcctctggaacaacgtcgtgcgcatcgcccccccgctcaacgtc
acgcaagcggagatcgaagaggcactcaagagcctcgacgaatcgttcgccgccttcgcc
gaggtcgcacgatga

DBGET integrated database retrieval system