KEGG   Leishmania major: LMJF_21_1210Help
Entry
LMJF_21_1210      CDS       T01014                                 

Definition
(RefSeq) putative thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lma  Leishmania major
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LMJF_21_1210
Enzymes [BR:lma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LMJF_21_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
21:complement(497568..498422)
Genome map
AA seq 284 aa AA seqDB search
MFRGRIELIIGPMFAGKTTELMRRVKREIHARRSCFVIKYSKDTRYDEHNVASHDQLMLR
AQAAVSQLTEVRDTWKRFDVLAIDEGQFFSDLVDFCNTAADAGKVVMVSALDGDYRRKPF
GQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVNVEQQELIGGADMYIATCRECYSKQ
QLPSIEEMRTQRMAIKEVEKRYLGLSDKRATASPQTPEKPAGGWCTKAGVATLPTMVKEG
AASSGASAGMKSGRGLCEMQAFTTETPKYQRVEPACTASAASSE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcggtcgtatagagctcattatcggcccgatgtttgccggcaagacaacggag
ctgatgcgccgcgtcaagcgcgagatccacgcccgtcgcagctgcttcgtcatcaagtac
tccaaggatacccgctacgatgagcacaacgttgcttcacacgaccagctgatgctgcgg
gcgcaggcggccgtctcgcagctgacggaggtgcgggacacgtggaagcggttcgacgtg
ctggcgatcgacgagggtcagtttttttctgacctggtagatttttgcaacactgccgca
gacgcgggcaaggtagtcatggtgtcggccctcgacggcgattaccggcgcaagccgttt
gggcagatctgcgagctcgtcccgtactgcgaggcggtggacaagctgacggcggtgtgc
atgatgtgccacgagcagcccgcctgctttactcggcgcaccgtgaacgtggagcagcag
gagctcattggtggcgcagacatgtacatcgcgacctgccgcgagtgctactcgaagcag
cagttgccctccatcgaggaaatgcggacgcagcggatggcgatcaaggaggtggagaag
cggtacctcggcttgtcagacaagagggcaaccgccagtccccagacacccgagaaaccg
gctggtggctggtgcactaaggccggggtcgcgacgctccccacgatggtaaaggaggga
gcggcctcgtccggggcgtcggccggtatgaagtcgggtcgaggcctgtgcgagatgcag
gccttcaccaccgagacgcccaagtaccagcgtgtggagcctgcgtgcacggcctcggct
gcatcctcagagtga

DBGET integrated database retrieval system