KEGG   Leuconostoc mesenteroides subsp. mesenteroides J18: MI1_07315Help
Entry
MI1_07315         CDS       T01768                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lmm  Leuconostoc mesenteroides subsp. mesenteroides J18
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MI1_07315
  Energy metabolism
   00680 Methane metabolism
    MI1_07315
Enzymes [BR:lmm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MI1_07315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1525114..1526628
Genome map
AA seq 504 aa AA seqDB search
MTSRKIPSIMGTQHPDNANAPFWESSQQPFISAYRETGEAFENFNELNVDEYMWDWEGKH
ADAAVIDRLFSTEYDYFKDHQIGRDKFLTFRFPNIWEEKGYNLMQAMTAFLSSEDFAHDL
GFSRPLFEAILPMAQRADQILKMQVLFEKLANFKSAEFTRSDKNTPYIEMIPLFEDFETQ
LHAPEILKEYLNLHEEHFGFRPKYMRVFLAGSDSALTAGFMSSITGNKLAIARLHEFAEE
ENIEIFPISGTGSAIFRGGLSPHRIDRYVTEFPGVRTATVQSAFRYDFPIEEVQKGIAEL
KEKLPVAEPLKISLDDQKILTEIAEESAKFYSNTLDNLVPSMQAIFKAFPKRRDRRQHVG
VLGYSRSVDGIELPRAINFTGSFYSVGVPPEFIGFGRALKHLDADHLSVFVRSYPSMSKD
FNELARFVNMDALQILKTQNAAWAEVEEDILIMQRIFKFEIGPQTREEQQHAEIALQVVQ
FKDGAPVAITALINRMAQLRHFLG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacatcacgtaaaatcccttcaatcatgggaacgcaacatccagataatgctaatgcg
ccattctgggaaagttctcagcaaccatttatcagtgcctatcgagaaaccggtgaagca
tttgaaaactttaatgaattaaatgtcgatgagtatatgtgggattgggaaggtaaacat
gctgatgcagctgtcattgatcgcttgtttagcacagagtatgattatttcaaagatcat
caaatcggtcgtgacaagtttttaactttccgtttccctaatatttgggaagaaaaaggc
tacaacttaatgcaagcgatgactgccttcttaagttctgaagacttcgcccatgatctt
ggattctctcgaccattatttgaagctattctgccaatggcacagcgtgcagaccaaatt
ttgaaaatgcaagttttgtttgaaaaattagcaaacttcaaatcagcagaatttactcgc
tctgataaaaacacaccctatattgaaatgatccctctttttgaggattttgaaacgcaa
ttacatgcacctgaaattttaaaggagtatttaaacctccacgaagaacattttggcttc
cgaccaaaatatatgcgtgtattcttagccggatctgattctgctttaacagctggattt
atgagttcaattaccggtaacaaactagcaattgcgcgacttcatgagtttgctgaagaa
gaaaacattgaaattttcccaatttcaggaaccggatcagcaattttccgtggtggttta
tctccacaccgcatcgatcgctacgtaacagaatttccaggggtacgcacagcaactgtt
caatcagcattccgttacgactttcctattgaagaagtgcaaaaaggcatcgctgaatta
aaagaaaaattgccggttgcagaaccattaaaaatttctcttgatgatcaaaagatttta
actgagatagctgaagagtccgctaagttttattctaatacgctagacaatttggttcct
agcatgcaagcgattttcaaggcgttcccaaagcgtcgtgatcgccgtcaacacgttggt
gttcttggatattcacgttcagttgatggcatcgaattaccaagggccattaacttcact
ggctcattctactcagtcggtgtcccaccagaatttattggttttgggcgcgcattgaag
catttagatgctgatcatttgagcgtatttgttcgctcatatcctagcatgagcaaagac
tttaatgaattagcacgcttcgttaatatggatgctttgcaaattctaaaaactcaaaat
gctgcttgggccgaagttgaagaagatattctcatcatgcaacgtattttcaagtttgaa
attggtcctcaaacgcgcgaagaacaacaacatgctgaaatagcacttcaagtagtgcaa
tttaaagatggtgctccagttgccattacagcccttattaaccgcatggcacaattacga
cacttcctcggataa

DBGET integrated database retrieval system