KEGG   Listeria monocytogenes SLCC5850: LMOSLCC5850_0854Help
Entry
LMOSLCC5850_0854  CDS       T02223                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lmoc  Listeria monocytogenes SLCC5850
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LMOSLCC5850_0854 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LMOSLCC5850_0854 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LMOSLCC5850_0854 (ddlA)
Enzymes [BR:lmoc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LMOSLCC5850_0854 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:lmoc01011]
 Precursor biosynthesis
  Amino acid ligase
   LMOSLCC5850_0854 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
873206..874318
Genome map
AA seq 370 aa AA seqDB search
MKTKLILLYGGKSAEHEVSLQTAFSVINALDLEKFEAAPIYITNEGEWIQGPLLSGKLDF
VEQLRFSATETVKLAATESEKSEGEAISPAVLEADGQETVVFPLLHGPNGEDGTVQGLFE
VLNIPYVGNGVLASSAAMDKIVMKKIFADAGIPQVPAVAVRLIDWKNYQEEMVAEMEEVL
TYPVFVKPANLGSSVGISKATNKKELVDAMTEAFLYDRRVVVEQGVVAREIEMGVLGNDT
PVCSVPGEILPEGAVATFYDYKAKYQDNNTALIIPTEVDPEILEQMKEYAIQAFLGLDAS
GLVRADFFLTEDNQLFLNEVNTMPGFTPYSMYPLLWQETGLPYGALIERLVDLAKERHAA
KNALKYKLED
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaaattaattttattatacggtggaaaatctgccgaacatgaagtttcatta
caaacagcattttcagttatcaatgctttggatttagaaaaattcgaagctgcgccaata
tacattacaaatgaaggcgagtggattcaaggaccgctgctttctgggaaattagatttt
gtcgaacaattacgtttttcggctacagaaactgtgaaacttgctgcgactgaatcagag
aaatcagaaggcgaagcgattagcccagcagttttagaagcagacggacaagaaacagtc
gtattcccacttttacatggaccgaacggggaagatggcactgttcaagggttgttcgaa
gtattaaatattccttacgttggcaatggtgtcttagcatcctctgctgcgatggacaaa
atcgtgatgaagaaaatctttgcagatgctggaatcccgcaagttccagcagttgctgtt
cgtttaattgattggaaaaattatcaagaggaaatggttgctgagatggaagaagtcctt
acatatcctgtcttcgtaaaaccagcaaaccttggttcgagtgttggtattagtaaggca
acaaacaaaaaagaattagtggacgcaatgacagaagcgtttttatatgaccgtcgtgtt
gttgttgaacaaggtgtcgttgctcgtgaaatcgaaatgggtgtacttggaaatgatacg
ccagtttgctctgtacctggcgaaattttgccagaaggtgctgttgccacattctacgat
tacaaagctaaatatcaagataacaatactgcgttaattattccgactgaagtagatcca
gaaatcttggaacaaatgaaagaatatgcgatccaagcgtttttaggtctggacgcaagc
ggactagtacgagcagactttttcttaacggaagataatcagttattcttaaatgaagtg
aatacaatgccaggttttacgccgtacagcatgtatcctcttctttggcaggaaacgggc
ttaccgtacggagcgctgattgaacgactagttgatttggcaaaagaacgccatgcagct
aaaaatgcacttaaatataaattagaagactaa

DBGET integrated database retrieval system