KEGG   Listeria monocytogenes La111: BN418_2881Help
Entry
BN418_2881        CDS       T02512                                 

Definition
(GenBank) Probable glutamate decarboxylase gamma
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmoe  Listeria monocytogenes La111
Pathway
lmoe00250  Alanine, aspartate and glutamate metabolism
lmoe00410  beta-Alanine metabolism
lmoe00430  Taurine and hypotaurine metabolism
lmoe00650  Butanoate metabolism
lmoe01100  Metabolic pathways
lmoe01110  Biosynthesis of secondary metabolites
lmoe01120  Microbial metabolism in diverse environments
lmoe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmoe00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BN418_2881
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN418_2881
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN418_2881
   00430 Taurine and hypotaurine metabolism
    BN418_2881
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BN418_2881
Enzymes [BR:lmoe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BN418_2881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CCQ21963
LinkDB All DBs
Position
complement(2348346..2349749)
Genome map
AA seq 467 aa AA seqDB search
MLYSEDDKRKQESYRIPLFGSEEESTSIPKYVLKKEPMEPRIAYQLVKDQLMDEGNARQN
LATFCQTYMEKEAEILMAETLEKNAIDKSEYPQTAELENRCVNILADLWNAPKDMSYLGT
STVGSSEACMLGGLAMKFRWRNNAEKRGLDIQAKRPNLIISSGYQVCWEKFCVYWDVDMR
VVPMDKNHLSLDVDKVFDLVDEYTIGVVGILGITYTGKFDDIQLLDEKVEAYNETNEHQL
VIHVDGASGAMFTPFVNPELPWDFRLKNVVSINTSGHKYGLVYPGVGWILWKDKEYLPKE
LIFEVSYLGGSMPTMAINFSRSASQIIGQYYNFLRYGFEGYREIHEKTKKTALYLAKTVE
KSGYFEIINDGANLPIVCYKMKEGLDVEWTLYDLADQLLMKGWQVPAYPLPADLSDTIIQ
RFVCRADLGYNVAEEFAADFADAIHNLEHARVLYHDKERNDSYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctttatagtgaagacgacaagcgaaaacaggaaagttatcgaatcccactctttgga
tctgaggaagaaagcacgagtatcccgaaatacgtattaaaaaaggagccgatggaacct
cgcattgcttatcaacttgtaaaagatcagttgatggatgagggaaatgcgcggcaaaac
ttagcgactttttgtcagacatacatggaaaaagaggcagaaatactgatggcagaaacg
ctcgagaaaaatgcaattgataaatctgaatatccacaaacggctgaactggaaaatcgg
tgcgtcaatatattagctgatttgtggaatgcgccaaaagatatgtcttacttggggact
tcgacagttgggtcttcggaagcttgtatgcttggcggtttggcaatgaagtttcgctgg
cgtaacaatgcggaaaaacgaggtctggatatacaggcaaaacgaccaaacttaattatt
tcatcaggttaccaagtatgttgggaaaaattctgtgtatactgggatgtcgatatgcgt
gttgtaccaatggataaaaaccaccttagtcttgatgtggacaaagtgtttgatttggtt
gatgagtatacaattggggttgtcgggattttaggcattacttatactggtaaatttgat
gatattcaattattagatgaaaaagtagaagcatacaatgaaacaaacgaacatcaatta
gtcattcatgttgacggagcaagcggcgcgatgtttacaccatttgtaaatccggaatta
ccttgggatttccgccttaaaaatgttgtttctataaatacttccggtcataaatacgga
ttggtttatccaggtgttggttggattttgtggaaagacaaagaatatttaccaaaagag
cttatttttgaagtcagctacttaggtggttcgatgccgacgatggcgattaacttctct
cgtagtgcgagccaaattattggtcaatattataatttcttacgatatggttttgaaggt
tatcgagaaattcatgaaaaaacaaagaaaacagccctttacttggcaaaaactgtagaa
aaaagtggctattttgaaattattaatgatggcgctaatttaccgattgtttgttacaaa
atgaaagaaggactggatgtagagtggacgctatatgacttggctgatcagcttttgatg
aaagggtggcaagttccagcctatccacttccggctgatttaagtgatacgattattcaa
cgatttgtttgccgggcggacttaggctataacgtggcagaagagtttgccgctgacttt
gcagatgcgattcataatctggaacatgctagagtgctgtatcatgacaaagaacgcaac
gattcatacggatttacgcactaa

DBGET integrated database retrieval system