KEGG   Listeria monocytogenes Lm60: IJ09_02810Help
Entry
IJ09_02810        CDS       T03479                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lmom  Listeria monocytogenes Lm60
Brite
Enzymes [BR:lmom01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     IJ09_02810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIL66726
UniProt: A0A2N9PXH8
LinkDB All DBs
Position
563965..564573
Genome map
AA seq 202 aa AA seqDB search
MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSAEELVTN
LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGNLKAAIESEFGTFDEFKEKFN
AAAAARFGSGWAWLVVNDGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRPE
YIDTFWNVINWDEANKRFDAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgaattacctaaattaccttatacttatgatgctttggagccgaattttgat
aaagaaaccatggaaattcactatacaaagcaccacaatacttatgtaacaaaactaaat
gaagcggttgctggtcatcctgaacttgcaagcaaatctgcggaagaattagttactaac
ctagatagcgttcctgaagatattcgcggcgctgtccgtaaccacggtggcggtcatgct
aaccatacattgttctggtctattcttagcccaaatggtggcggcgctccaactggcaat
ttaaaagcagcaatcgaaagcgaattcggtacttttgacgaatttaaagaaaaattcaat
gcagcagctgcagcacgttttggttctggttgggcttggctagtagttaatgatggcaaa
ttagaaatcgtttctacagctaaccaagattctccattaagcgatggcaaaacacccgtt
cttggcttagatgtttgggaacatgcttactaccttaaattccaaaaccgtcgtcctgaa
tatatcgacacattttggaatgttattaactgggatgaagctaacaaacgctttgacgca
gctaaataa

DBGET integrated database retrieval system