KEGG   Listeria monocytogenes R479a: LMR479A_0456Help
Entry
LMR479A_0456      CDS       T03180                                 

Gene name
gadA
Definition
(GenBank) Glutamate decarboxylase alpha
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
lmr  Listeria monocytogenes R479a
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LMR479A_0456 (gadA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMR479A_0456 (gadA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMR479A_0456 (gadA)
   00430 Taurine and hypotaurine metabolism
    LMR479A_0456 (gadA)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    LMR479A_0456 (gadA)
Enzymes [BR:lmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LMR479A_0456 (gadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
463059..464447
Genome map
AA seq 462 aa AA seqDB search
MFKTNVEQNNVPVFGSFESGQDLPEKRMNKESVDPRIAYQLVKDQLIDEGSARQNLATFC
QTYMEPEAEQIMAETMEKNAIDKSEYPQTAKLESSCVNMLADLWNVDESEHYMGTSTVGS
SEACMLGGMAMKFRWRSAALKNGLDIHAKKPNLVISSGYQVCWEKFCVYWDIELREVPMS
EEHLSINTDIIMDYVDEYTIGIVGILGITYTGKFDDIMTLNDLVEDYNNTHDNEVVIHVD
GASGAMFTPFVEPGLEWDFRLPNVVSINTSGHKYGLVYPGVGWILWRDKEYLPEELVFDV
SYLGGHMPTMAINFSRSASQIIGQYYNFLRFGYEGYRQIHMRTRDGALQLSQAVAETGLF
EIYNDGANLPIVCYKLKDDANVAWTLYDLADRLQMKGWQVPAYPLPKEMGNTIIQRYVCR
GDLGQNMVTAFKNDLSESIEELNNAHILYHDVNTSKTHGFTH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaacaaatgttgaacaaaataatgtaccggtgtttggctcttttgagtcagga
caagatttaccagaaaaacgcatgaataaggaatctgtagatccaagaattgcttatcaa
cttgtgaaggatcaactgattgatgagggttcagcgagacaaaatctagctacgttctgt
caaacatatatggaaccggaagctgagcaaatcatggcagaaacgatggagaaaaatgct
attgataaatcagaatatccacagacagcaaagcttgagtctagttgtgtgaatatgttg
gcggatctttggaatgtggatgaatcggagcattacatgggaacgtcgacggttggttct
agtgaggcgtgtatgcttggtggaatggctatgaaatttagatggaggagtgctgcactc
aaaaatggattagacatccacgctaaaaaaccaaacttggttatttcttcaggctatcaa
gtttgttgggaaaagttctgtgtgtactgggatattgagttacgtgaagtaccgatgagt
gaggagcatttgagtatcaatacagatatcataatggactatgtagatgaatatacaatt
ggtattgtgggtattctgggcatcacctatacagggaaattcgacgatatcatgacttta
aatgaccttgtggaagactataataatacacatgacaatgaagttgtaattcatgttgac
ggtgcgagtggtgcaatgtttacaccgtttgttgagccgggtttagaatgggattttcga
ttaccaaatgttgtttcgattaatacatcagggcacaaatatggtcttgtatacccaggt
gtaggctggattttatggcgggacaaggaatatttgccagaagaattagtgtttgatgtg
agctatcttggtgggcatatgcctacgatggccatcaatttttccagaagtgcgagtcag
attatcggtcagtattataatttcttacgcttcggatatgagggttatcgtcaaattcat
atgcgtacaagagatggtgccttgcaattatcacaagctgttgcagaaacaggacttttc
gaaatttataacgatggcgcaaacttaccaatcgtatgttacaaactaaaagacgatgct
aatgtggcgtggacgctttatgacttggcagatcgcttacaaatgaaaggttggcaagta
ccggcgtatccacttccaaaagaaatgggtaacacaattattcaacgttacgtttgtcgc
ggcgatttaggacaaaatatggttacagctttcaaaaacgatttgagtgaaagtattgaa
gaactaaataacgctcatattttatatcatgatgtcaatacatctaaaacacatggcttt
actcattaa

DBGET integrated database retrieval system