KEGG   Lactobacillus mucosae: LBLM1_08515Help
Entry
LBLM1_08515       CDS       T03814                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00473  D-Alanine metabolism
lmu00550  Peptidoglycan biosynthesis
lmu01100  Metabolic pathways
lmu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lmu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LBLM1_08515
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LBLM1_08515
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LBLM1_08515
Enzymes [BR:lmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LBLM1_08515
Peptidoglycan biosynthesis and degradation proteins [BR:lmu01011]
 Precursor biosynthesis
  Amino acid ligase
   LBLM1_08515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATPgrasp_ST ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AJT51001
UniProt: A0A0D4CM96
LinkDB All DBs
Position
complement(1814458..1815591)
Genome map
AA seq 377 aa AA seqDB search
MTNKKLHVALLFGGNSSEHDVSKRSAHNVFDAMDKNKYDVSLFMFTKDGILLNNEYSQRI
FDGEPEDAVVKEAYANMDLDAPLAPIQALSTVKQIDFFIPVIHGNLGEDGTVQGLFRLLK
KPYIGSGIAASAMSFDKDLTKKIITQAGIRNTPYILLTPENRDQYDWHAIQEELGDLVFV
KPAKQGSSVGIHKVENEAELKAALDDAFKYDFKVLVEQGIDHPREIEISILGNEHPIASK
LGGIRVPSDDPFYDYENKFVDASGVVFDLPVILPDDLTQEITDMALKAYKALGMKGLCRI
DFLVDQNNVPYLSEPNTLPGFTNISLYPQMWEVSGIKYSDLIDRLIKLGLEEFERQEQIK
YDFQSLGEEKVGKKEYH
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacaaaaagctgcacgtagcattgctgttcgggggcaattcttcggaacacgat
gtctctaaacggagcgctcacaatgtatttgacgcgatggacaagaacaaatatgacgtc
agcctgtttatgttcaccaaagatggaattctgctgaacaatgaatactcacagcggatc
tttgacggcgaaccagaagatgccgtagtcaaggaagcttatgccaatatggatcttgat
gcgccactcgcaccaattcaagcattgagcacggttaagcagatcgatttcttcattccg
gttattcacggtaacttaggtgaggatggtacggtccaggggctgttccgtctgttgaag
aagccatatattggttcaggaattgctgccagtgccatgtcgtttgacaaggatctgacc
aagaagatcattacgcaagctggaatccgcaatacgccatacattctgctgacgccagaa
aatcgcgatcagtacgactggcatgccatccaagaagaacttggcgatctggtattcgtt
aagccagccaagcaaggttcttcagtcggaattcataaagttgaaaacgaggctgaatta
aaggctgctcttgatgatgcctttaagtatgactttaaggtcttggttgagcaggggatt
gatcaccctcgtgaaattgaaatctcaattcttggtaatgagcatccaatcgcttctaag
cttggcggtatccgcgtaccaagcgatgacccattctacgactatgaaaataaatttgtc
gatgccagtggcgtggtctttgatctgccggtaatcctgccagacgacctgacgcaggaa
attaccgatatggcactgaaagcttacaaggcacttggcatgaagggactttgccgaatt
gacttcctggttgaccaaaacaatgttccatacttgagtgagccgaatacgctgccaggt
ttcaccaacatcagtctttatccgcagatgtgggaagtttctggcattaagtactcagat
ttaattgatcgcctgattaagctgggcctggaagaatttgaacggcaagaacagattaag
tatgatttccagtcgcttggtgaagaaaaggtcggtaaaaaagaataccactaa

DBGET integrated database retrieval system