KEGG   Lactobacillus mucosae: LBLM1_08805Help
Entry
LBLM1_08805       CDS       T03814                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lmu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LBLM1_08805
Enzymes [BR:lmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LBLM1_08805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M ABC_transp_aux Glyco_hydro_42C
Motif
Other DBs
NCBI-ProteinID: AJT51047
UniProt: A0A0D4CLM7
LinkDB All DBs
Position
complement(1871404..1873410)
Genome map
AA seq 668 aa AA seqDB search
MKQLLYGVAYYFEYLPYDRIDQDIEMMKAAGINVVRIGESTWSTYEPHDGEFDFSKLIYT
LDKMDKNGMKVIVGTPTYAFPTWLAKEYPDVLVERQGKRLPYGARQIMDITNPTFRFYAE
RIIRQMMLVTREYDNVIGYQVDNETKHYGTSSHNVQAGFVDYLKQEFNGDLDALNAEFGL
DYWSNRINAWEDFPNVNGTINGSLAGEFAKYQRQLVTDYLAWQTAIVREYTHDDQFVTHN
FDFEWRGYSYGVQPDVDHFAAAKPLDVVGIDVYHPSQRQLTGAEISFAGDIARSIKQQNY
LVLETQAQAFKTWTPYPGQLFQLAFSHVANGANMVEYWHWHSIHNSFETYWKGLLSHDFQ
PNPVYNEAQKVGAAFQKLSADLVNLKHAAKVAFVVDNASLTATSGPWMEFGIGEDAKYND
VFRRLYDAFYRQNIATDVLNPELIDPAKYDLLVVPMLYTATDDFLQKLNDYVENGGHVLY
TFKDGVANEHVKVRTTRQPGIISKAVGAHYEMFVDPNGEGLADNSGIFKDVDNQISNWAE
LLETDGAKVLATYDRHWKSYAAITENTFGKGMTWYLGCWPNEEVVARLVEHIVDVLGLAD
SYHTQFPLIVKSGTNEQAEKIDFIFNYSDEKQAFIMPFAATELLADASVSAEQKVEMAPW
EVKIMKRG
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattgttatatggagttgcctattatttcgaatatctcccgtatgatcgcatt
gatcaagacattgaaatgatgaaggcagctgggatcaacgtggttcgtattggtgaaagc
acctggagcacctatgagccgcatgatggtgaatttgattttagtaaattgatttatact
ctggataaaatggataaaaacggcatgaaagtaatagttgggacgccaacttatgctttt
ccaacctggctggccaaagaatatccggatgtattggttgaacggcaaggaaagcgtctg
ccatatggtgctcgccagattatggacattactaatccgacttttcgtttttatgcggag
cggatcattcgacagatgatgctggtgacgcgcgaatacgataatgtgatcggttatcaa
gtcgacaatgaaaccaaacattatgggacttccagccataacgtgcaggctgggtttgtc
gattatctaaagcaagaatttaatggcgatctggatgctttgaacgctgaatttggcttg
gattactggtcaaatcgtattaatgcctgggaagactttccaaatgttaatggaacgatc
aatggcagtctggcaggcgaatttgccaagtaccaacgccagctggtgaccgattatctg
gcatggcagacagcaatcgtacgtgaatatacgcatgatgaccaatttgttactcacaat
tttgattttgaatggcgtggctattcatatggggtacagcctgatgttgatcattttgca
gctgccaagcctttagacgtagtagggattgacgtctaccatccttcgcagcgtcagttg
acgggggcagagatttcgtttgctggtgatattgcccgttcaatcaagcagcagaactat
ctggtcttagaaacgcaggcacaggcatttaagacttggacgccatatccaggccagctt
ttccaattagccttttcgcatgttgccaacggcgccaacatggttgaatactggcactgg
cattcaatccataattcgtttgagacttactggaagggccttttgagtcatgatttccag
cctaatccagtctataacgaggcccaaaaagttggggcagcctttcaaaagctgtcagct
gatctggtcaatctcaaacacgcggccaaggttgcttttgtcgttgataatgccagtctg
acagcaacttccggaccatggatggaatttggtattggcgaggacgctaaatataatgat
gttttccgtcgtttgtatgatgctttctatcgtcaaaatatcgctaccgacgttttgaat
cccgaactgattgatccggctaagtatgatctattggtcgtgccaatgctctatacggca
actgatgacttcttacagaaactgaatgactatgttgaaaatggcggtcacgtcctctac
acgtttaaagacggtgttgccaacgagcatgtcaaggttagaacgactcgtcagccaggg
atcatcagcaaagcggtaggggctcattatgaaatgtttgtcgatcctaatggtgaggga
ttggctgataattccggcatttttaaagacgttgacaatcagatcagcaactgggctgag
cttttggaaactgatggtgcgaaggttttagctacttatgatcgccattggaagtcatac
gcggcaattactgaaaacacgtttggcaaagggatgacctggtatctgggatgctggcca
aatgaggaggtcgttgcacgcttagttgagcatattgttgatgtattggggctggctgac
agctatcatactcaattcccactgattgttaagagtggtactaatgagcaggctgaaaaa
attgattttatttttaattattcagatgaaaagcaagcattcataatgccgtttgcggcc
actgaactgttggctgatgcttcagtatcggctgaacaaaaagtcgaaatggcaccgtgg
gaagttaagatcatgaaaagaggatga

DBGET integrated database retrieval system