KEGG   Listeria monocytogenes 08-5923: LM5923_2512Help
Entry
LM5923_2512       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LM5923_2512
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LM5923_2512
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LM5923_2512
   00430 Taurine and hypotaurine metabolism
    LM5923_2512
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    LM5923_2512
Enzymes [BR:lmy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LM5923_2512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2514875..2516269
Genome map
AA seq 464 aa AA seqDB search
MLYSKENKESYLEPVFGSSAEDRDIPKYTLGKEPLEPRIAYRLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKDQKFMGTSTI
GSSEACMLGGMAMKFAWRKRAEKLGLDIYAKKPNLVISSGYQVCWEKFCVYWDIDMRVVP
MDKEHMQLNTDQVLDYVDEYTIGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTG
YFDIFNDGSHLPIVCYKLKKDANVKWTLYDLADRLQMRGWQVPAYPLPKSLENIIIQRYV
CRADLGFNMAEEFIQDFQASIQELNNAHILFHDTQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaataaagaaagttatttagaaccagttttcggatcaagtgca
gaggatcgtgatattcctaaatacaccctcggaaaagaaccactcgaacctcggattgct
taccgtttagtgaaagacgaacttttagatgaaggttccgcccgccaaaacctagctact
ttttgccaaacatatatggaagacgaagcaaccaaattaatgtccgaaacactagaaaaa
aatgcaatcgataaatctgaatacccaagaacagctgaacttgaaaatcgttgcgtcaat
attatcgctgacttatggcatgcacctaaggaccaaaaatttatgggaacttccacaatc
ggctctagtgaagcgtgtatgcttggcggaatggcaatgaaatttgcttggagaaaacgt
gccgaaaaacttggcctagatatttatgcaaaaaaaccaaatctcgttatctcctctggc
taccaagtgtgttgggaaaaattctgtgtttactgggatatcgatatgcgcgttgttcca
atggataaagagcacatgcaactcaataccgatcaagtccttgattacgtcgatgaatat
acaatcggtgtggtcggcatcctcggtatcacttacacaggccgctatgatgacatctac
gcgctaaatgaaaaacttgaagaatacaatagcaaaaccgattataaagtctacattcac
gtcgatgcagctagtggaggtttcttcactccatttgtcgaacctgacattatctgggac
ttccgtttgaaaaacgttatctcaattaatacttccggtcacaaatacggcctcgtttat
ccaggtatcggttgggtcctttggaaagatgaaagctacctaccagaagaactcattttt
aaagtcagctatcttggcggagaaatgccaaccatgcaaatcaatttctcccgtagtgcg
agccacatcatcggtcaatactacaatttcttacgctacggcttcgaaggctaccgcacc
attcaccaaaaaactagcgacgtcgcacaataccttgctcacgcagtcgaacaaactggc
tactttgacatttttaacgatggctcccacttaccaatcgtctgctataaattaaaaaaa
gacgctaatgtaaaatggacattatacgatttagcggaccgcctccaaatgcgcggctgg
caagttcccgcatatccactaccaaaaagcttggaaaacattattattcaacgttacgtc
tgccgcgctgaccttggtttcaacatggcagaagaattcatccaagatttccaagcctct
attcaagaactaaacaacgcccacatccttttccacgatacccaacaatccggcgtccac
ggcttcacacattaa

DBGET integrated database retrieval system