KEGG   Lelliottia nimipressuralis: CWR52_03395Help
Entry
CWR52_03395       CDS       T05333                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lni  Lelliottia nimipressuralis
Pathway
lni00020  Citrate cycle (TCA cycle)
lni00480  Glutathione metabolism
lni01100  Metabolic pathways
lni01110  Biosynthesis of secondary metabolites
lni01120  Microbial metabolism in diverse environments
lni01130  Biosynthesis of antibiotics
lni01200  Carbon metabolism
lni01210  2-Oxocarboxylic acid metabolism
lni01230  Biosynthesis of amino acids
Module
lni_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lni_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lni00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CWR52_03395
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CWR52_03395
Enzymes [BR:lni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CWR52_03395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AVH16292
UniProt: A0A2L2J903
LinkDB All DBs
Position
complement(702496..703746)
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGKKITLQNGKINVPHNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAKEEFGGELIDGGPWQKIKNPNTGKEIIIKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMEWFEAADLIVKGMEGAINAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcggaaggtaaaaagatcaccctgcaaaacggcaag
attaacgttcctcacaatccgattattccgttcatcgaaggtgacggtatcggtgtagac
gttaccccggcaatgctgaaagtggttgatgccgctgttgagaaagcctacaaaggcgag
cgtaaaatttcctggatggaaatttacaccggtgagaaatcgacgcaagtttatggccag
gacgtctggctgccagcagaaacgctggacctgatccgcgactaccgtgttgctattaaa
ggccccctgactaccccagtcggcggcggtatccgttccctgaacgtggcgctgcgtcag
gagctggacctgtacgtctgtctgcgtccggttcgttactatcagggcaccccaagcccg
gttaagcaccctgaactgaccgacatggttatcttccgcgaaaactcagaagacatctac
gcgggtatcgaatggaaagcggactctgctgacgcagaaaaagtgattaaattcctgcgc
gaagagatgggcgtgaagaaaattcgcttccctgagcattgtggtatcggcattaagccg
tgctccgaagaagggaccaagcgtctggtgcgtgcagcaatcgaatatgcgatcaccaac
gaccgtgactctgtgaccctggttcacaaaggcaacatcatgaagttcaccgaaggcgcg
ttcaaagactggggctaccagttggcgaaagaagagttcggcggtgagctgatcgacggc
ggcccatggcagaagatcaagaacccgaacaccggcaaagagatcatcattaaagatgtg
atcgccgatgcgttcctgcagcagatcctgctgcgtcctgcagaatacgacgtgattgcc
tgtatgaacctgaacggtgactacatctctgacgccctggcagcgcaggttggtggtatc
ggtatcgcccctggcgcgaacatcggtgacgagtgcgccctgttcgaagcgacccacggt
actgcaccaaaatacgcaggtcaggacaaagtgaacccaggctctatcattctgtccgca
gagatgatgctgcgtcatatggaatggttcgaagccgcagacctgatcgttaaaggtatg
gaaggcgcgatcaacgcgaaaaccgtcacgtacgatttcgaacgtctgatggaaggcgct
aagctgctgaaatgctcagagtttggcgacgcgattatcgcgaacatgtaa

DBGET integrated database retrieval system