KEGG   Legionella oakridgensis: Loa_00804Help
Entry
Loa_00804         CDS       T03928                                 

Gene name
sodC
Definition
(GenBank) Cu/Zn superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lok  Legionella oakridgensis
Brite
Enzymes [BR:lok01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Loa_00804 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AHE66372
UniProt: W0BCM8
LinkDB All DBs
Position
complement(727891..728385)
Genome map
AA seq 164 aa AA seqDB search
MKKLPVIFTSFILSISTSYAAEVIAKIYTTDGSHQLLGQVVFKDTEYGLLISPDLKDLPP
GPHGLHLHQHPDCGDKGMEAGGHFDPQKTGTHRGPYGQGHLGDLPVLYVNKNGTANTITL
APRLKTSNLQNMSVMIHAGGDNYSDNPELGGGGARIACGVINKD
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgccggttatttttacctcctttatattaagtatctccaccagctatgcc
gcagaagtcattgccaagatttatactacagatggtagccatcaattgcttggacaagtc
gtgtttaaagacactgaatacggtttactaatttccccagacttaaaagatttacctccg
ggcccacacggattacatctgcatcaacatcctgattgcggcgataaaggcatggaagca
ggtggacattttgatccacaaaaaacaggcacgcatcggggaccttatggacaagggcat
ttaggcgatttaccagtgctgtatgtcaataaaaatggaacagccaatacaatcactctg
gcgccacgtttaaaaaccagtaatcttcaaaacatgtccgtgatgattcatgccggcgga
gataattacagtgacaaccccgaacttggcggtggtggtgcgcgaatagcttgtggtgtt
atcaataaggactaa

DBGET integrated database retrieval system