KEGG   Legionella oakridgensis: Loa_02406Help
Entry
Loa_02406         CDS       T03928                                 

Definition
(GenBank) DNA ligase D, 3''-phosphoesterase domain protein
Organism
lok  Legionella oakridgensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2225578..2226174)
Genome map
AA seq 198 aa AA seqDB search
MSKHNLGAYKKNRDFKRTNEPKEDKAASTCRRIFVIQKHDASHLHYDFRLQNEDVLVSWA
VPKGLSTIPNKKHLAIRTEDHPVDYAQFEGVIPKGEYGAGTVLVWDIGDYEPLMEDGEKS
MNEALVKGALKIKLQGKKLQGGYALARIRKKKDKEQWVIFKLDDKFADARRNPVSTEPDS
VLSGRSLEEIAEEEQDDE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacacaatttaggtgcttataaaaagaacagagattttaaaagaacaaacgag
ccgaaagaggataaggcagcctcaacctgccgacgtatttttgttattcaaaaacatgat
gcaagtcatttgcattatgattttaggttgcaaaatgaggatgttttagtctcttgggcg
gtgcctaaaggtctttcgacgattccaaataaaaagcatttagcgataagaacagaagat
catccagtggattatgcacaatttgaaggcgttatacctaaaggagaatatggagcagga
accgtattggtatgggatattggtgattatgaaccactgatggaggatggtgaaaaatca
atgaatgaagcgcttgtaaaaggtgcattgaaaatcaagttgcaaggcaaaaagttacaa
ggaggatatgcgcttgcgcgcatccggaaaaagaaagataaagaacaatgggttattttc
aaattggatgataagtttgctgatgccaggcgtaatccagtcagcacggaaccagactca
gttttgagtggtcgttctctagaagaaattgccgaagaagaacaagatgatgaataa

DBGET integrated database retrieval system