KEGG   Lokiarchaeum sp. GC14_75: Lokiarch_42400Help
Entry
Lokiarch_42400    CDS       T04015                                 

Gene name
ppcA_2
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
loki  Lokiarchaeum sp. GC14_75
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:loki00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lokiarch_42400 (ppcA_2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Lokiarch_42400 (ppcA_2)
   00720 Carbon fixation pathways in prokaryotes
    Lokiarch_42400 (ppcA_2)
   00680 Methane metabolism
    Lokiarch_42400 (ppcA_2)
Enzymes [BR:loki01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Lokiarch_42400 (ppcA_2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 489 aa AA seqDB search
MVKNGVKIPRCMSTQHPDNVNSPFFVNNAIIGGEDEIKEAYYAFSHLGCDEQMWDCEGKE
VDSYVVKKLLTKYKSFFSEKTLGKDLNLTLRGPNPSVERAEAKVLLEALESIPRSFDAAR
LFYNDDIAPIFEVILPMTASSMEINNVYRYYSDIVVGKETKILTHGKTTIGDWIGEFKPK
KINVIPLFEDIEHMLNAHDITRDYLQDKNLEYQRVFLARSDPALNYGLISAVLLNKVTLQ
RLYRLSEEINVEIYPIIGAGSSPFRGNLRPQNVENVLEEYPSVSTFTIQSAFKYDNPPED
VIKAINKLQKTRVKQPQEINEERCLEIINKYLIEYQKQVVNLAPVINDVARYVPSRRKRK
LHIGLFGYSRNMEGIALPRAIKFTAALYSLGLPPEILGLNALNNDDFQFVSKVYVHFEKD
LKDSLKYLNIESRFIPKELKEFLRDFPIYSEVDEIHKKITEKIQDIKNSEKVNLEEYILS
AANIRKFLG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagaatggtgtaaaaatccccaggtgtatgagtacgcaacaccctgacaatgta
aactctcccttttttgtaaataacgcaattattgggggtgaagacgaaataaaagaagca
tattatgctttttctcatctaggatgtgacgagcaaatgtgggattgtgaagggaaggaa
gttgatagttatgtagttaaaaaattattaacaaaatataaatcttttttcagtgaaaaa
acactaggcaaggatttaaacctaactttaagaggaccaaacccatcagttgaaagggcg
gaagcaaaagtcttattagaagcattagaaagcattccaaggtcgtttgatgctgctaga
ttattttacaatgatgatatagcaccaatttttgaggttattttgccaatgacggcctca
tcaatggaaataaacaatgtttacaggtattactcagatatcgtcgtaggaaaagaaact
aaaatattaactcacggaaagacaacgattggtgattggatcggagaattcaaaccgaaa
aaaatcaatgttatacctctttttgaagatattgagcatatgctaaatgcacacgacata
acacgagactacttacaagataaaaatttagaatatcaacgtgtttttttagcaagatca
gaccccgcattaaattatggtcttattagcgctgttcttttgaacaaggttaccctccaa
agattatatagattatcagaagagataaatgttgaaatttatccaattataggggcaggg
tcctctccatttagaggcaatcttagaccacaaaatgtagaaaatgttttagaggaatat
ccaagtgtaagcacgtttaccatacaatcagcatttaagtatgataatcctcctgaagat
gttattaaagccattaacaaattacaaaaaacaagagtaaaacaacctcaagaaataaat
gaagaaagatgtttagagataattaataaatatttgatagaatatcaaaaacaagtagta
aatttagcaccagtaatcaatgatgttgcaagatatgtgccgagtagaaggaaaaggaag
ctacatataggtctctttggttattctcgaaacatggaaggaattgccttgcctagagca
attaaatttacagcggcgctctattctttaggattaccgccagaaatattaggtttaaac
gcattaaataacgatgactttcaatttgttagtaaggtctatgtacattttgaaaaagat
ttgaaagactcattgaaatatttaaacattgaaagtcgttttataccaaaagaacttaaa
gagtttctgagagactttccgatatattcagaagtcgatgaaattcataagaagataaca
gaaaaaattcaagatatcaaaaatagtgaaaaagtaaatctagaagaatatattttaagt
gcagcaaatataagaaaatttctcgggtga

DBGET integrated database retrieval system