KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_03203Help
Entry
lpa_03203         CDS       T01232                                 

Definition
(GenBank) saframycin Mx1 synthetase B
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2610091..2611836
Genome map
AA seq 581 aa AA seqDB search
MKKEYLQCQSLVDVVRLRALHSPKKKSCTFLNKELEETMTYEQLDLHAKAIAATLQAEGA
KPGDRVLLLFAPGLPLIQAFLGCLYAGCIAVPIYPPAQEKLLDKAQRIVTNSKPVIVLMI
ADHIKKFTADELNTNPQFLKIPAIALESIELNRSSSWQPTSIKSNDIAFLQYTSGSTMHP
KGVMVSHHNLLDNLGKIFTSFHMNDETIIFSWLPPHHDMGLIGCILTPIYGGIQAIMMSP
FSFLQNPLSWLKHITKYRATISGSPNFAYDYCVKRIREEKKEGLDLSSWVTAFNGAEPVR
AETMEHFYQAFKDYGFRKEAFYPCYGLAEATLLVTGGTPGNPYKTLTLAKEQFQDHRVHF
ADDNSPGSYKLVSSGNPIQAVKIIDPDTLIPCDFDQVGEIWVQSNSVAKGYWNQPEETKH
AFAGKIKDDESSAIYLRTGDLGFLHENELYVTGRIKDLIIIYGKNHYPQDIEFSLMHSPL
HHVLGKCAAFVIQEEHEYKLTVMCEVKNRFMDDVAQDNLFNEIFELVYENHQLEVHTIVL
IPLKAMPHTTSGKIRRNFCRKHLLDKTLPIVATWQLNKIEE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaagaatatttgcagtgccagtctctggtggacgtcgtcaggttacgggctttg
catagccctaaaaagaaaagctgtacttttctgaacaaagaactagaagagacgatgacc
tatgagcagctggatctacacgccaaagcaattgcggcaactttgcaagcagaaggagca
aaacctggggatagggtcttgttattatttgcaccaggattgccccttatccaggcattt
ttgggctgcctttatgccggctgcattgctgtacccatttacccaccggctcaagaaaaa
ttattggataaagcacaacgcattgttaccaactcaaaaccggtcatagtactaatgatt
gcggatcatatcaaaaaattcaccgcagacgaattaaatacaaatccccaattcctgaaa
attcctgctattgcgcttgagagcattgagttaaacagaagtagtagttggcaaccaacc
tccattaagagcaatgacattgcgtttctacaatacacttccggctcaaccatgcaccct
aaaggagtgatggtaagccaccataatttgctggataatctgggtaaaatttttacctct
tttcatatgaatgatgaaaccattattttcagctggctgcccccacatcatgatatgggt
ttgattggctgcattcttacacccatctatggtggaattcaggcaatcatgatgtcccct
ttctcatttttacaaaacccgctttcctggttaaaacatattaccaaatacagagccact
atcagtggcagccccaatttcgcttacgattattgtgtcaagcgaatcagggaagaaaaa
aaagaagggctggatttaagttcatgggtgaccgcattcaatggcgctgagccagtgcga
gcagaaaccatggaacatttttatcaggcatttaaagactatggatttcgtaaagaagcc
ttctacccatgctatggcctggctgaggctactttgttagtgaccggaggaacaccagga
aatccatacaaaacgttaactctggccaaagaacaatttcaggatcatcgcgtgcatttt
gcagacgataacagtccgggcagttacaagctagtcagcagtggtaatcccattcaagca
gttaaaattatagatcctgataccttgatcccatgtgattttgaccaggttggtgaaatt
tgggtacaaagtaacagtgtcgcaaaaggatattggaatcaacccgaagaaacgaagcat
gcgttcgcaggaaaaattaaagacgatgagagtagcgcaatctatttaagaactggggac
ttgggctttctccatgaaaatgagctatacgttactggacgcattaaagacttaattatt
atttatggtaaaaatcattaccctcaggacatagagttcagcctgatgcattctcctctc
catcacgtattgggcaaatgcgctgcttttgtgattcaggaggagcatgaatataaactg
actgtgatgtgtgaagtaaaaaatcgattcatggatgacgtagctcaagacaatttattc
aatgagatttttgagcttgtttacgaaaaccaccaattggaggtacatactatagtcctg
attcctcttaaagcaatgccacatactaccagcggaaaaattcgcaggaatttttgccga
aaacatcttttggataaaactctgccaatagtagctacctggcaactcaataaaattgag
gaataa

DBGET integrated database retrieval system