KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_04349Help
Entry
lpa_04349         CDS       T01232                                 

Gene name
sodA
Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Brite
Enzymes [BR:lpa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     lpa_04349 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3472305..3472883
Genome map
AA seq 192 aa AA seqDB search
MTFTLPQLPYALDALAPHVSKETLEYHYGKHHNTYVTNLNKLIPGTEFESMTLEEIIMKA
KGGIFNNAAQVWNHTFYWHSMSPNGGGEPKGRLAEAINKSFGSFAAFKEQFSQTAATTFG
SGWAWLVQDQSGALKIISTSNAGTPMTEGLNALLTCDVWEHAYYIDYRNRRPDYIEAFWS
LVNWDFASSNLK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaccctgccgcaattaccttatgcattggatgcactggctcctcatgtttcc
aaagaaaccttggaataccattatggtaaacaccataatacttacgttaccaacttaaat
aaattaattcccggaacagaatttgaatccatgactctggaagagatcatcatgaaagct
aaaggcggcatttttaacaatgcggctcaggtttggaatcacaccttttattggcacagc
atgagtcctaatggtggaggcgagccaaaaggcaggctggcggaagccattaataaaagc
tttggttcttttgcagcattcaaagaacaattttcacaaacagctgctacaacattcggt
tccgggtgggcatggttagtccaggatcagtcgggggctttaaaaattatcagcacaagc
aatgctggaacaccaatgactgaaggattaaatgccttattaacttgtgacgtatgggag
cacgcttattacatcgattatagaaataggcgcccggattatattgaagccttttggtca
ttagttaattgggattttgcgagcagtaatctgaaataa

DBGET integrated database retrieval system