KEGG   Lactobacillus paracasei subsp. paracasei JCM 8130: LBPC_2266Help
Entry
LBPC_2266         CDS       T04768                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lpap  Lactobacillus paracasei subsp. paracasei JCM 8130
Pathway
lpap00010  Glycolysis / Gluconeogenesis
lpap00260  Glycine, serine and threonine metabolism
lpap00680  Methane metabolism
lpap01100  Metabolic pathways
lpap01110  Biosynthesis of secondary metabolites
lpap01120  Microbial metabolism in diverse environments
lpap01130  Biosynthesis of antibiotics
lpap01200  Carbon metabolism
lpap01230  Biosynthesis of amino acids
Module
lpap_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lpap_M00002  Glycolysis, core module involving three-carbon compounds
lpap_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lpap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBPC_2266
  Energy metabolism
   00680 Methane metabolism
    LBPC_2266
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBPC_2266
Enzymes [BR:lpap01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LBPC_2266
Membrane trafficking [BR:lpap04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LBPC_2266
Exosome [BR:lpap04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LBPC_2266
  Exosomal proteins of melanoma cells
   LBPC_2266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAN72562
UniProt: A0A0E1PJ97
LinkDB All DBs
Position
complement(2389319..2389990)
Genome map
AA seq 223 aa AA seqDB search
MVKLVLLRHGESIANQKNTYTGWSDVGLTAEGKAQAETAGEKIASTGILFDHVHTSVLSR
AIMTAYIVQDKIGQNYLPITKSWRLNERHYGALRGINKDLTRKLFGPDQVESWRRSFSAH
PPLLANPSRTRRYHCYPATIIPRGESLADASQRLLPYWTAELAPRLLSGKNQLIVAHGST
LRALVKFMEDISDAGINKVEIGNAQPIVYTLDDKITILDKQTL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaattagtcctgttaaggcatggcgagagcatcgccaatcagaagaatacttat
accggctggtcggatgtgggtttaaccgcagagggtaaggcacaggctgagacagctggg
gaaaaaatcgcgtccacggggatcttgtttgatcatgttcatacgagcgtgctatcgcgg
gcaatcatgacggcatacatcgtgcaagataagatcggccagaactacctgccgatcacg
aaaagttggcggcttaatgagcggcattacggtgccttacgtggtattaacaaggacttg
acgcgcaagctgtttggcccggatcaggttgaaagttggcggcggagtttttccgcacat
ccgccattacttgctaatcctagtcgaacccggcggtaccactgttatccagccacgatc
atcccgcgcggcgagagcctcgccgatgcgagtcaacggttgttaccgtattggacagct
gaactggcaccgcgccttttgtccgggaaaaatcagctcattgtcgctcacggctctact
ttgcgcgccttggtgaagtttatggaagacatcagcgatgctggcatcaacaaggtcgaa
attggaaatgcgcaaccaattgtttacaccttggatgacaagataaccattctggataag
caaactttataa

DBGET integrated database retrieval system