KEGG   Lactobacillus plantarum B21: SH83_02605Help
Entry
SH83_02605        CDS       T03680                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lpb  Lactobacillus plantarum B21
Pathway
lpb00010  Glycolysis / Gluconeogenesis
lpb00260  Glycine, serine and threonine metabolism
lpb00680  Methane metabolism
lpb01100  Metabolic pathways
lpb01110  Biosynthesis of secondary metabolites
lpb01120  Microbial metabolism in diverse environments
lpb01130  Biosynthesis of antibiotics
lpb01200  Carbon metabolism
lpb01230  Biosynthesis of amino acids
Module
lpb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lpb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lpb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SH83_02605
  Energy metabolism
   00680 Methane metabolism
    SH83_02605
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SH83_02605
Enzymes [BR:lpb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SH83_02605
Membrane trafficking [BR:lpb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SH83_02605
Exosome [BR:lpb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SH83_02605
  Exosomal proteins of melanoma cells
   SH83_02605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AJO73294
UniProt: A0A0P8Z3C6
LinkDB All DBs
Position
575191..575868
Genome map
AA seq 225 aa AA seqDB search
MTELVLVRHGESTANRDNTYTGWSDVPLTAVGIAQAHQAGKRLRATGLQFGAVHTSVLKR
AIVTANIMLSEIDQLWLPEYKTWRLNERHYGALRGQNKDVTRQEYGKAQVQQWRRSFYTV
PPLLTPAELDHDRRYTKYGAAVEPRGESLKMAYDRIMPYWIDEIAPRLLDGQNQLVVAHG
STLRAMIKYLEHISDTGIDGVEVANGVPICYHLDRQLHVIGKEEY
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacagaactagtattggttcgccatggtgagagtacggccaatcgggataatacgtat
accggttggagtgacgtcccgctaacagcagtgggtattgcacaggctcatcaagctggc
aagcgattacgagctacgggactgcagtttggcgctgtgcatacctcagtcctaaaacgg
gctatcgttaccgcgaatattatgttaagtgaaattgatcagttatggctgcctgagtat
aagacgtggcggttaaatgaacgacattacggtgccttacgtggtcaaaataaggatgtg
actcgtcaagagtacggtaaggcgcaagttcaacagtggcggcggagcttttatacggtg
ccgccgttgttgacaccagctgaactagaccatgatcgacgttacaccaagtacggtgcc
gccgtcgaaccgcggggagaaagcttgaagatggcttacgaccgcatcatgccttattgg
atcgatgagattgcaccgcggttgttagacggccaaaaccaactcgtggtggcgcatggt
agtacgttgcgtgcgatgatcaaatatttagagcatattagtgatactgggattgatggt
gtcgaagttgctaacggagtgccaatttgttatcaccttgatcggcaactgcacgttatc
ggtaaagaagagtattaa

DBGET integrated database retrieval system