KEGG   Legionella pneumophila Corby: LPC_1696Help
Entry
LPC_1696          CDS       T00532                                 

Definition
(GenBank) saframycin Mx1 synthetase B; CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II
Organism
lpc  Legionella pneumophila Corby
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2636332..2638077
Genome map
AA seq 581 aa AA seqDB search
MKKEYLQCQSLVDVVRLRALHSPKKKSCTFLNKELEETMTYEQLDLHAKAIAATLQAKGA
KPGDRVLLLFAPGLPLIQAFLGCLYAGCIAVPIYPPAQEKLLDKAQRIVTNSKPVIVLMI
ADHIKKFTADELNTNPQFLKIPAIALESIELNRSSSWQPTSIKSNDIAFLQYTSGSTMHP
KGVMVSHHNLLDNLGKIFTSFHMNDETIIFSWLPPHHDMGLIGCILTPIYGGIQAIMMSP
FSFLQNPLSWLKHITKYRATISGSPNFAYDYCVKRIREEKKEGLDLSSWVTAFNGAEPVR
AETMEHFYQAFKDYGFRKEAFYPCYGLAEATLLVTGGTPGNPYKTLTLAKEQFQDHRVHF
ADDNSPGSYKLVSSGNPIQAVKIIDPDTLIPCDFDQVGEIWVQSNSVAKGYWNQPEETKH
AFAGKIKDDESSAIYLRTGDLGFLHENELYVTGRIKDLIIIYGKNHYPQDIEFSLMHSPL
HHVLGKCAAFVIQEEHEYKLTVMCEVKNRFMDDVAQDNLFNEIFELVYENHQLEVHTIVL
IPLKAMPHTTSGKIRRNFCRKHLLDKTLPIVATWQLNKIEE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaagaatatttgcagtgccagtctctggtggacgtcgtcaggttacgggctttg
catagccctaaaaagaaaagctgtacttttctgaacaaagaactagaagagacgatgacc
tatgagcagctggatctacacgccaaagcaattgcggcaactttgcaagcaaaaggagca
aaacctggggatagggtcttgttattatttgcaccaggattgccccttatccaggcattt
ttgggctgcctttatgccggctgcattgctgtacccatttacccaccggctcaagaaaaa
ttattggataaagcacaacgcattgttaccaactcaaaaccggtcatagtactaatgatt
gcggatcacatcaaaaaattcaccgcagacgaattaaatacaaatccccaattcctgaaa
attcctgctattgcgcttgagagcattgagttaaacagaagtagtagttggcaaccaacc
tccattaagagcaatgacattgcgtttctacaatatacttccggctcaaccatgcaccct
aaaggagtgatggtaagccaccataatttgctggataatctgggtaaaatttttacctct
tttcatatgaatgatgaaaccattattttcagctggctgcccccacatcatgatatgggt
ttgattggctgcattcttacacccatctatggtggaattcaggcaatcatgatgtcccct
ttctcatttttacaaaacccgctttcctggttaaaacatattaccaaatacagagccact
atcagtggcagccccaatttcgcttacgattattgtgtcaagcggatcagggaagaaaaa
aaagaagggctggatttaagttcatgggtgaccgcattcaatggcgctgagccagtgcga
gcagaaaccatggaacatttttatcaggcatttaaagactatggatttcgtaaagaagcc
ttctacccatgctatggcctggccgaggctactttgttagtgaccggaggaacaccagga
aatccatacaaaacgttaactctggccaaagaacaatttcaggatcatcgcgtgcatttt
gcagacgataacagtccgggcagttacaagctagtcagcagtggtaatcccattcaagca
gttaaaattatagatcctgataccttgatcccatgtgattttgaccaggttggtgaaatt
tgggtacaaagtaacagtgtcgcaaaaggatattggaatcaacccgaagaaacgaagcat
gcgttcgcaggaaaaattaaagacgatgagagtagcgcaatctatttaagaactggggac
ttgggctttctccatgaaaatgagctatacgttactggacgcattaaagacttaattatt
atttatggtaaaaatcattaccctcaggacatagagttcagcctgatgcattctcctctc
catcacgtattgggcaaatgcgctgcttttgtgattcaggaggagcatgaatataaactg
actgtgatgtgtgaagtaaaaaatcgattcatggatgacgtagctcaagacaatttattc
aatgagatttttgagcttgtttacgaaaaccaccaattggaggtacatactatagtcctg
attcctcttaaagcaatgccacatactaccagcggaaaaattcgcaggaatttttgccga
aaacatcttttggataaaactctgccaatagtagctacctggcaactcaataaaattgag
gaataa

DBGET integrated database retrieval system