KEGG   Legionella pneumophila Lens: lpl2154Help
Entry
lpl2154           CDS       T00208                                 

Definition
(GenBank) hypothetical protein
Organism
lpf  Legionella pneumophila Lens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2461958..2463703
Genome map
AA seq 581 aa AA seqDB search
MKKEYLQCQSLVDVVRLRALHSPKKKSCTFLNKELEEIMTYEQLDQHAKAIAATLQAEGA
KPGDRVLLLFAPGLPLIQAFLGCLYAGCIAVPIYPPAQEKLLDKAQRIVTNSKPVIVLMI
ADHIKKFTADELNTNPKFLKIPAIALESIELNRSSSWQPTSIKSNDIAFLQYTSGSTMHP
KGVMVSHHNLLDNLNKIFTSFHMNDETIIFSWLPPHHDMGLIGCILTPIYGGIQAIMMSP
FSFLQNPLSWLKHITKYRATISGSPNFAYDYCVKRIREEKKEGLDLSSWVTAFNGAEPVR
AETMEHFYQAFKEFGFRKEAFYPCYGLAEATLLVTGGTPGSPYKTLTLAKEQFQDHRVHF
ADDNSPGSYKLVSSGNPIQAVKIIDPDTLIPCDFDQVGEIWVQSNSVAKGYWNQPEETEH
AFSGKIKENENSPIYLRTGDLGFLHENELYVTGRIKDLIIIYGKNHYPQDIEFSLMHSPL
HHVLGKCAAFVIQEEHEYKLTVMCEVKNRFMDDVAQDNLFNEIFELVYENHQLEVHTIVL
IPLKAMPHTTSGKIRRNFCRKHLLDKTLPIVATWQLNKIEE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaagaatatttgcagtgccagtccctggttgatgtcgtaaggttacgtgcttta
cacagccctaagaagaaaagctgtacttttctgaacaaagagttggaagagataatgact
tatgagcaactggatcaacacgccaaagctattgcggcaactttgcaagcggaaggagca
aaacctggtgacagggtattgctgttatttgcgcctggattgccccttatccaggccttt
ttgggctgtctttacgcaggttgcattgctgtacccatttacccaccagcccaagaaaaa
ttattggacaaggcacaacgcatagttaccaactcaaaaccggtcatagtactgatgatt
gcggatcacatcaaaaaattcaccgcagacgaattaaatacaaatcccaaattcctgaaa
attcctgctattgcgctcgagagcattgagttaaacagaagtagtagttggcaaccaacc
tccattaagagcaatgacattgcgtttttacaatacacttccggctcaaccatgcaccct
aaaggagtgatggtaagccaccataatttactggataatctgaataaaatttttacctct
tttcatatgaatgatgaaaccattattttcagctggctacccccacatcatgatatgggt
ttgattggctgcattctgacacccatctatggtggaattcaggcaatcatgatgtcccct
ttctcatttttacaaaacccgctttcctggttaaaacatattactaaatacagagccact
attagtggcagccccaacttcgcttacgattattgtgtcaaacgaatcagggaagaaaaa
aaagaaggtctggatttaagttcatgggtgaccgctttcaacggtgctgagccagtacga
gcagaaaccatggaacatttttatcaggcatttaaagagtttggatttcgcaaagaagcc
ttctatccatgctatggcctggctgaggctactttgttagtgacgggaggaacaccagga
agtccatacaaaacattaactctggccaaagaacaatttcaagatcatcgcgtacatttt
gctgacgataacagtccaggcagttacaagttagtcagcagtggtaatcccattcaagca
gttaaaattatagatcctgataccttgatcccatgtgattttgaccaggttggtgaaatt
tgggtacaaagtaacagtgtcgccaaaggatattggaatcaacccgaagaaacagagcat
gcattctcagggaaaattaaagaaaatgagaatagcccaatctatttaagaaccggggac
ttgggctttctccatgaaaatgagttatacgttactggacgcattaaagacttaattatt
atttatggtaaaaatcattatcctcaggacatagagttcagcctgatgcactctcctctc
catcacgtattgggcaaatgcgctgcttttgtgattcaggaagagcatgaatataaactg
actgtgatgtgtgaagtaaaaaatcgattcatggatgacgtagctcaagacaatttattc
aatgagatttttgagcttgtttacgaaaaccaccaattggaggtacatactatagtcctg
attcctcttaaagcaatgccacataccaccagcggaaaaattcgcaggaatttttgccga
aaacatcttttggataaaactctgccaatagtggctacctggcaactcaataaaattgag
gaataa

DBGET integrated database retrieval system