KEGG   Legionella pneumophila subsp. pneumophila HL06041035: LPV_2491Help
Entry
LPV_2491          CDS       T02174                                 

Gene name
fabD
Definition
(GenBank) Long-chain-fatty-acid--CoA ligase
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2591360..2593090
Genome map
AA seq 576 aa AA seqDB search
MQCQSLVDVVRLRALHSPNKKSCTFLNKELEETMTYEQLDQHAKAIAATLQAEGAKPGDR
VLLLFAPGLPLIQAFLGCLYAGCIAVPIYPPAQEKLLDKAQRIVTNSKPVIVLMIADHIK
KFTADELNTNPKFLKIPAIALDSIELNRSSSWQPTSIQSNDIAFLQYTSGSTMHPKGVMV
SHHNLLDNLNKIFTSFHMNDETIIFSWLPPHHDMGLIGCILTPIYGGIQAIMMSPFSFLQ
NPLSWLKHITKYRATISGSPNFAYDYCVKRIREEKKEGLDLSSWVTAFNGAEPVRAETME
HFYQAFKEFGFRKEAFYPCYGLAEATLLVTGGTPGSPYKTLTLAKEQFQDHRVHFADDNS
PGSYKLVSSGNPIQAVKIIDPDTLIPCDFDQVGEIWVQSNSVAKGYWNQPEETKHAFAGK
IKDDERSAIYLRTGDLGFLHENELYVTGRIKDLIIIYGKNHYPQDIEFSLMHSPLHHVLG
KCAAFVIQEEHEYKLTVMCEVKNRFMDDVAQDNLFNEIFELVYENHQLEVHTIVLIPLKA
MPHTTSGKIRRNFCRKHLLDKTLPIVATWQLNKIEE
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgccagtctctggttgacgtcgtcaggttacgtgctttacacagccctaacaag
aaaagctgtacttttctgaacaaagagttagaagagacgatgacttatgagcaattggat
caacacgccaaagcaattgcggcaactttgcaagcagaaggagcaaaacccggggatagg
gtcttgttattgtttgcacctggattaccccttatccaggcatttttgggctgcctttat
gcaggctgcattgctgtacccatttacccaccagcccaagaaaaattattggacaaggca
caacgcatagttaccaactcaaaaccggtcatagtactgatgattgcggatcacatcaaa
aaattcaccgcagacgaattaaatacaaatcccaaattcctgaaaattcctgctattgcg
cttgatagcattgagttaaacagaagtagtagttggcaaccaacctccattcagagcaat
gacattgcgtttttacaatacacctccggctcaaccatgcaccctaaaggagtgatggta
agccaccataatttactggataatctgaataaaatttttacctcttttcatatgaatgat
gaaaccattattttcagctggctgcccccacatcatgatatgggtttgattggctgcatt
ctgacacccatctatggtggaattcaggcaatcatgatgtcccctttctcatttttacaa
aacccgctttcctggttaaaacatattactaaatacagagccactattagtggcagcccc
aatttcgcttacgattattgtgtcaagcgaatcagggaagaaaaaaaagaagggctggat
ttaagttcatgggtgaccgctttcaacggtgctgagccagtgcgagcagaaaccatggaa
catttttatcaggcatttaaagagtttggatttcgcaaagaagccttctatccatgctat
ggcctggctgaggctactttgttagtgacgggaggaacaccaggaagtccatacaaaaca
ttaactctggccaaagaacaatttcaagatcatcgcgtacattttgctgacgataacagt
ccaggcagttacaagttagtcagcagtggtaatcccattcaagcagttaaaattatagat
cctgataccttgatcccatgtgattttgaccaggttggtgaaatttgggtacaaagtaac
agtgtcgccaaaggatattggaatcaacccgaagaaacaaagcatgcgttcgcagggaaa
attaaagacgatgagcgtagcgcaatctatttaagaaccggggacttgggctttctccat
gaaaatgagttatacgttactggacgcattaaagacttaattattatttatggtaaaaat
cattatcctcaggacatagagttcagcctgatgcattctcctctccatcacgtattgggc
aaatgtgctgcttttgtgattcaggaggagcatgaatataaactgactgtgatgtgtgaa
gtaaaaaatcgattcatggatgacgtagctcaagacaatttattcaatgagatttttgag
cttgtttacgaaaaccaccaattggaggtacatactatagtcctgattcctcttaaagca
atgccacatactaccagcggaaaaattcgcaggaatttttgccgaaaacatcttttggat
aaaactctgccaatagtggctacctggcagctcaataaaattgaggaataa

DBGET integrated database retrieval system