KEGG   Lactobacillus plantarum JDM1: JDM1_1595Help
Entry
JDM1_1595         CDS       T00946                                 

Gene name
pyk
Definition
pyruvate kinase
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Overview; Carbon metabolism [PATH:lpj01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lpj01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lpj00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lpj00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lpj00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
complement(1691852..1693612)
Genome map
AA seq 586 aa AA seqDB search
MKKTKIVSTLGPASTDTDTIVKLIEAGANIFRFNFSHGDHEEHLDRLNKVHEAEKITGKT
VGIMLDTKGAEIRTTVQANGKSEYKIGDKVRITMDDSLDTTHDKIAVTYKNLYDDVHVGG
HVLFDDGLLDMKIDEKDEANRELVTTVQNAGVLGSRKGVNAPGVSINLPGITEKDSSDIR
FGLDHEINYIAASFVRKPQDVLDIRELLEEKHMEHVQIFPKIESQEGIDNADEILKVCDG
LMVARGDMGVEIPAENVPLVQKSLIKKCNALGMPVITATQMLDSMQENPRPTRAEASDVA
NAVFDGTDATMLSGESANGLYPVESVAMMAKIDEKAENTLAENGTLQLNRFDKTSVTETI
GIAIARAAKNLNIKTIVAATESGYTAKMISKYRPNADILAITFDERTQRGLMVNWGVQPI
VAEKPETTDDMFDLAASKAVELGFAKEGDLILITAGVPVGERGTTNIMKIQLIGSKLADG
QGVGDETVIGKAVIATSAQEAIDKAVEGGVLVTKTTDKDYLPAIEKSSALVVENGGLTSH
AAVVGISMGIPVIVGVKDATSVIADGQLITVDSRRGLVYRGASNAL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaccaagattgtttcaacacttggtcctgccagcaccgatactgacactatt
gttaaattaatcgaagccggcgcaaatattttccgctttaacttttcacatggtgatcat
gaagaacatttagatcgcttaaacaaagttcacgaagcagaaaagattacgggtaagacc
gttggtatcatgcttgatactaagggtgctgaaattcggacgaccgttcaagctaacgga
aaatctgaatacaagatcggtgacaaggttcgtatcaccatggatgattcattagatacg
acccatgataagattgccgttacttacaagaacctctatgatgatgttcatgtaggtggc
catgtcctctttgatgatggtttattagatatgaagatcgacgaaaaggacgaagctaac
cgcgaattggttacaactgttcaaaacgccggcgttttaggctcacgtaagggtgttaac
gctcctggcgtttcaatcaacttacctgggatcactgaaaaagactcaagtgatattcgc
tttggtttggatcatgaaatcaactacatcgctgcttcattcgttcgtaagccacaagat
gtcttagacattcgtgaattacttgaagaaaagcacatggaacacgttcaaatcttccct
aagatcgaatcacaagaaggtatcgacaacgccgatgaaattcttaaggtttgtgatggt
ttgatggttgctcgtggtgacatgggtgttgaaattcctgctgaaaatgtgccattggta
caaaagagtttaatcaagaagtgtaatgctttaggtatgcctgttatcacggctactcaa
atgttagactcaatgcaagaaaacccacgtcctactcgtgccgaagcttctgacgttgcc
aacgctgtctttgatggtactgacgcaacgatgctttctggtgaaagtgctaacggtctt
taccctgttgaatctgttgccatgatggctaagattgacgaaaaggctgaaaacactttg
gctgaaaacggtacgttacaattaaaccgtttcgacaagactagtgttactgaaacaatc
ggtattgcgattgctcgggcagctaagaacttgaacattaagacgattgttgctgcgact
gaatctggctacactgctaagatgatttcgaagtaccgtccaaatgctgatatcttagca
atcacttttgacgaacggactcaacgtggcttaatggttaactggggtgttcaaccaatc
gtggctgaaaaaccagaaaccactgatgacatgtttgatttagctgcttctaaggctgtt
gaacttggctttgccaaggaaggcgacttaatcttgattactgccggtgtgccagttggc
gaacgcggtacgactaacatcatgaagatccaattaattggttctaagttagctgatggt
caaggtgtcggtgatgaaacggttatcggtaaagccgtaatcgcaacgtctgctcaagaa
gctatcgacaaggccgttgaaggtggcgtcttagttactaagacgactgacaaagactac
ttaccagcaatcgaaaagtctagtgctttagttgttgaaaacggtggtttaacttcacac
gctgctgttgttggtatctcaatgggaattcctgttatcgttggtgttaaggacgctact
agtgttattgctgatggtcaattgatcacagttgattcacgtcgtggccttgtataccgc
ggtgcttcaaacgccctttaa

DBGET integrated database retrieval system